BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0581 (343 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1527 - 38006174-38006815,38006920-38007420 34 0.025 08_02_0949 - 22920363-22920685,22922621-22922824,22923170-229232... 30 0.55 01_06_0149 - 27011183-27011836 29 0.72 06_01_0908 - 7006160-7007488 28 1.7 02_05_1167 - 34638709-34639104,34640653-34642158 28 1.7 01_06_1018 - 33870063-33870209,33872044-33872094 28 2.2 12_02_0247 + 16409988-16411367 27 2.9 03_06_0758 - 36052261-36052301,36052463-36052697,36052895-360529... 27 2.9 02_05_0883 - 32481502-32483085 27 2.9 05_04_0234 + 19282196-19282818,19282948-19283347 27 3.9 11_06_0766 - 27115441-27115760,27115878-27116025,27116213-271174... 27 5.1 09_01_0005 - 193214-193228,193659-193776,193876-194072,194534-19... 27 5.1 03_01_0181 + 1464082-1464626,1465327-1465480 27 5.1 02_03_0120 + 15463163-15465250 27 5.1 11_01_0682 - 5575297-5575308,5575391-5575516,5575779-5575885,557... 26 6.7 10_02_0103 - 5320938-5321145,5321254-5321819 26 6.7 05_05_0175 + 22966151-22967614 26 6.7 05_06_0137 + 25936516-25936606,25936716-25937268,25937436-259379... 26 8.9 02_05_0559 - 29953309-29953722,29953852-29953938,29954280-299543... 26 8.9 02_04_0090 - 19643182-19643322,19644192-19644335,19644563-196446... 26 8.9 >01_06_1527 - 38006174-38006815,38006920-38007420 Length = 380 Score = 34.3 bits (75), Expect = 0.025 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +3 Query: 177 THGDLTPIPLTEQREPPVPCLNNVNSFTGCFLFS 278 T GD+TP + R VPC+ N T CFLF+ Sbjct: 326 TAGDVTPELILSIRRSEVPCMYNSRPTTACFLFA 359 >08_02_0949 - 22920363-22920685,22922621-22922824,22923170-22923263, 22923376-22923470,22923612-22923783 Length = 295 Score = 29.9 bits (64), Expect = 0.55 Identities = 18/45 (40%), Positives = 20/45 (44%) Frame = +2 Query: 35 G*AQAPIPSGHLHDPRGRPVALDAASVCAFLHPLVALVRTYLVAH 169 G A PIP GH H P GR + L+ P V T L AH Sbjct: 30 GAAGDPIPHGHGHTPHGRELELELFFPKCMESPASEAVVTGLPAH 74 >01_06_0149 - 27011183-27011836 Length = 217 Score = 29.5 bits (63), Expect = 0.72 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = -3 Query: 266 AASKGVDVVEAGNGWFSLFR--KWNWGEVSVSENNEP 162 AAS G D +A N W L++ +W +G +SVS N P Sbjct: 161 AASPGSD--DAENVWLELYQVGRWGFGRLSVSAANPP 195 >06_01_0908 - 7006160-7007488 Length = 442 Score = 28.3 bits (60), Expect = 1.7 Identities = 16/29 (55%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = +2 Query: 95 ALDAASVCAFL-HPLVALVRTYLVAHYFH 178 ALDA + CA LVALVRTY H+ H Sbjct: 298 ALDAIAGCADCKRELVALVRTYTPDHFEH 326 >02_05_1167 - 34638709-34639104,34640653-34642158 Length = 633 Score = 28.3 bits (60), Expect = 1.7 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = -3 Query: 284 FNRKEEAASKGVDVVEAGNGWFSLFRKW-NWGEVSVSENNEPPDKCEQEPREDEG 123 F + E G D ++A NG + W WG ++N+E P K Q +++ G Sbjct: 366 FEERCEEGDGGADHLDA-NGVAKDKKGWFGWGGKKGTKNDEKPSKANQGSKDESG 419 >01_06_1018 - 33870063-33870209,33872044-33872094 Length = 65 Score = 27.9 bits (59), Expect = 2.2 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +2 Query: 80 RGRPVALDAASVCAFLHP 133 +GRP+AL++ C F HP Sbjct: 33 QGRPLALESVPACCFYHP 50 >12_02_0247 + 16409988-16411367 Length = 459 Score = 27.5 bits (58), Expect = 2.9 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 2/29 (6%) Frame = +2 Query: 128 HPLVALVRTY--LVAHYFHSRRPHPNSTY 208 HP+V Y +V+H F +RPHP S Y Sbjct: 251 HPVVVNGAAYFLVVSHSFDRQRPHPPSHY 279 >03_06_0758 - 36052261-36052301,36052463-36052697,36052895-36052966, 36056477-36056567,36056650-36056872,36056964-36057300, 36057406-36057588 Length = 393 Score = 27.5 bits (58), Expect = 2.9 Identities = 13/39 (33%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = -3 Query: 200 NWGEVSVSENNEP-PDKCEQEPREDEGKRKH*QRPAPLG 87 +W +S + N P P C P E +GK+ +PA G Sbjct: 38 SWPALSEAARNPPKPPPCIDSPSEGQGKQSSRHKPARRG 76 >02_05_0883 - 32481502-32483085 Length = 527 Score = 27.5 bits (58), Expect = 2.9 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = +2 Query: 77 PRGRPVALDAASVCAFLHPLVALVRTYLVAHYFHSRRPH 193 P R +AL + L P L+ T LV YF SR PH Sbjct: 118 PLARRLALSVHARVLKLFPSHLLLSTCLVRFYFASRLPH 156 >05_04_0234 + 19282196-19282818,19282948-19283347 Length = 340 Score = 27.1 bits (57), Expect = 3.9 Identities = 15/48 (31%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Frame = -3 Query: 278 RKEEAASKGVDVVEAGNGWFSL-FRKWNWGEVSVSENNEPPDKCEQEP 138 ++E AA G E GW + ++WG E N P D C+ P Sbjct: 141 KREVAAFLGQTSHETTGGWPTAPDGPFSWGYCFKQEQNPPSDYCQPSP 188 >11_06_0766 - 27115441-27115760,27115878-27116025,27116213-27117417, 27117510-27117753,27120181-27120357 Length = 697 Score = 26.6 bits (56), Expect = 5.1 Identities = 9/21 (42%), Positives = 18/21 (85%) Frame = -3 Query: 290 LSFNRKEEAASKGVDVVEAGN 228 ++ ++E+AAS G+++V+AGN Sbjct: 25 MTVEKEEQAASTGMEIVKAGN 45 >09_01_0005 - 193214-193228,193659-193776,193876-194072,194534-195493 Length = 429 Score = 26.6 bits (56), Expect = 5.1 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = -1 Query: 148 NKSHERMKESANTSSVQRHWAS-TRVVKMS*RYRRLRLATLVPNP 17 N+ + ++KE A + ++ +R K S +YRRL L LVP P Sbjct: 244 NQGNTKVKEMARVNKERKPAPLLSRAEKRSDKYRRLPLDQLVPPP 288 >03_01_0181 + 1464082-1464626,1465327-1465480 Length = 232 Score = 26.6 bits (56), Expect = 5.1 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +1 Query: 7 PGLQDSARGWLSAGADTFRTSS 72 P + SAR W SAG +FR+SS Sbjct: 115 PERRGSARRWDSAGGSSFRSSS 136 >02_03_0120 + 15463163-15465250 Length = 695 Score = 26.6 bits (56), Expect = 5.1 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = +2 Query: 68 LHDPRGRPVALDAASV 115 LHDP G VALDA S+ Sbjct: 173 LHDPDGNHVALDAGSI 188 >11_01_0682 - 5575297-5575308,5575391-5575516,5575779-5575885, 5575911-5576013,5576122-5576187,5576378-5576461, 5577448-5577522,5577615-5577668,5577752-5577895, 5578632-5578685,5578877-5578981,5579076-5579173, 5579660-5579729,5580444-5580566,5580647-5580727, 5580996-5581476,5581684-5581816,5582550-5582598, 5582704-5582892,5583642-5583703,5583762-5585316 Length = 1256 Score = 26.2 bits (55), Expect = 6.7 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = -3 Query: 281 NRKEEAASKGVDVVEAGNGWFSLFRKWNWGEVSVSENNEPPDKCEQEPRED 129 N+KEE KG ++ N + LF+ N + + + DKCE+ +E+ Sbjct: 445 NKKEED-DKGHRTMDDENFFRRLFKDKNEEKKGAAHDRNDDDKCEEGDKEN 494 >10_02_0103 - 5320938-5321145,5321254-5321819 Length = 257 Score = 26.2 bits (55), Expect = 6.7 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = -1 Query: 79 RVVKMS*RYRRLRLATLVPNPAA 11 R+VK+S R+R++ L VP PAA Sbjct: 230 RLVKISIRHRQIWLRKYVPRPAA 252 >05_05_0175 + 22966151-22967614 Length = 487 Score = 26.2 bits (55), Expect = 6.7 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = -2 Query: 105 ASSATGRPRGS*RCPEGIGACA*PPSCRILQP 10 +SSA G PR + RC G G+ PPS L P Sbjct: 82 SSSAAGTPRSAARCGGG-GSPGAPPSSPPLSP 112 >05_06_0137 + 25936516-25936606,25936716-25937268,25937436-25937932, 25938030-25938090,25938411-25938482,25938563-25938634, 25938730-25938810,25938918-25939081,25939174-25939442, 25939531-25939657,25939778-25939846,25939944-25940136, 25940232-25940733 Length = 916 Score = 25.8 bits (54), Expect = 8.9 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -3 Query: 218 SLFRKWNWGEVSVSENNEPPD 156 SLF +WN+G +S +E PD Sbjct: 198 SLFGRWNFGPISTTEFIRYPD 218 >02_05_0559 - 29953309-29953722,29953852-29953938,29954280-29954385, 29954468-29954559,29955187-29955438 Length = 316 Score = 25.8 bits (54), Expect = 8.9 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = -2 Query: 69 RCPEGIGACA*PPSCRILQ 13 RCP AC PP CR Q Sbjct: 31 RCPADTSACRRPPPCRRAQ 49 >02_04_0090 - 19643182-19643322,19644192-19644335,19644563-19644626, 19644710-19644796,19645371-19645513,19645706-19645771, 19645954-19646046,19646165-19646230,19646363-19646433, 19646882-19646982,19647217-19647317,19647421-19647528, 19647639-19648064 Length = 536 Score = 25.8 bits (54), Expect = 8.9 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +2 Query: 161 VAHYFHSRRPHPNS 202 VAH+ H R PHP S Sbjct: 47 VAHHHHGRHPHPPS 60 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,556,191 Number of Sequences: 37544 Number of extensions: 227034 Number of successful extensions: 747 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 734 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 747 length of database: 14,793,348 effective HSP length: 73 effective length of database: 12,052,636 effective search space used: 482105440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -