BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0581 (343 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_9469| Best HMM Match : IRK (HMM E-Value=0) 66 7e-12 SB_58706| Best HMM Match : IRK (HMM E-Value=0) 61 2e-10 SB_43914| Best HMM Match : IRK (HMM E-Value=5.3) 37 0.004 SB_41714| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.015 SB_57503| Best HMM Match : Brevenin (HMM E-Value=2) 35 0.015 SB_39907| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.99 SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_42097| Best HMM Match : DUF1605 (HMM E-Value=3e-15) 28 1.7 SB_37663| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.3 SB_21209| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.3 SB_38188| Best HMM Match : rve (HMM E-Value=5.7e-31) 27 3.0 SB_1505| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.3 SB_59353| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.3 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 26 7.0 SB_21415| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.0 SB_4588| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.0 SB_57246| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.0 SB_55820| Best HMM Match : WD40 (HMM E-Value=0.18) 26 9.2 SB_53823| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.2 SB_33207| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.2 SB_43621| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.2 >SB_9469| Best HMM Match : IRK (HMM E-Value=0) Length = 520 Score = 66.1 bits (154), Expect = 7e-12 Identities = 38/105 (36%), Positives = 50/105 (47%) Frame = +3 Query: 27 TRVAKRRRRYLQDIFTTLVDAQWRWTLLVXXXXXXXXXXXXXXXXXXXXXTHGDLTPIPL 206 T VA++ YL D+FTT++D++WRW L+ G Sbjct: 110 TDVAQKHGMYLSDLFTTMIDSKWRWISLLFITAYTGSWMGFGCVWYLITYLRGGNY---- 165 Query: 207 TEQREPPVPCLNNVNSFTGCFLFSVETQHTIGYGSRTTNEECPEA 341 C++NV SF FLFS+ETQ TIGYG R + ECPEA Sbjct: 166 ---------CVHNVESFVTAFLFSLETQTTIGYGGRQISGECPEA 201 >SB_58706| Best HMM Match : IRK (HMM E-Value=0) Length = 385 Score = 61.3 bits (142), Expect = 2e-10 Identities = 37/102 (36%), Positives = 45/102 (44%) Frame = +3 Query: 33 VAKRRRRYLQDIFTTLVDAQWRWTLLVXXXXXXXXXXXXXXXXXXXXXTHGDLTPIPLTE 212 V ++ YL D FTTL+DA+W W L I Sbjct: 65 VENKKALYLADPFTTLLDAKWGWIFLAFASGFVTSWLFFGTLWWM----------IVKLR 114 Query: 213 QREPPVPCLNNVNSFTGCFLFSVETQHTIGYGSRTTNEECPE 338 R C++NV+S+ FLFSVETQ TIGYG R ECPE Sbjct: 115 TRFDTASCVDNVDSWISAFLFSVETQTTIGYGGRQVTPECPE 156 >SB_43914| Best HMM Match : IRK (HMM E-Value=5.3) Length = 141 Score = 37.1 bits (82), Expect = 0.004 Identities = 14/30 (46%), Positives = 22/30 (73%), Gaps = 1/30 (3%) Frame = +3 Query: 27 TRVAKRRRRYL-QDIFTTLVDAQWRWTLLV 113 T V K+ R YL +D+FTT++D +W W +L+ Sbjct: 81 TNVPKKLRLYLREDLFTTMIDMKWHWVILL 110 >SB_41714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 35.1 bits (77), Expect = 0.015 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 2/59 (3%) Frame = -3 Query: 221 FSLFRKWNWGEVSVSE--NNEPPDKCEQEPREDEGKRKH*QRPAPLGVHEGREDVLKVS 51 FS R W G + E + E D RED+ + H +P+P H+G+ED+ VS Sbjct: 59 FSAGRHWRLGRIPSFEGASYEEKDSASDSSREDDNR--HSPQPSPRPKHDGKEDIPLVS 115 >SB_57503| Best HMM Match : Brevenin (HMM E-Value=2) Length = 247 Score = 35.1 bits (77), Expect = 0.015 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 2/59 (3%) Frame = -3 Query: 221 FSLFRKWNWGEVSVSE--NNEPPDKCEQEPREDEGKRKH*QRPAPLGVHEGREDVLKVS 51 FS R W G + E + E D RED+ + H +P+P H+G+ED+ VS Sbjct: 170 FSAGRHWRLGRIPSFEGASYEEKDSASDSSREDDNR--HSPQPSPRPKHDGKEDIPLVS 226 >SB_39907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 594 Score = 29.1 bits (62), Expect = 0.99 Identities = 22/80 (27%), Positives = 36/80 (45%) Frame = -3 Query: 278 RKEEAASKGVDVVEAGNGWFSLFRKWNWGEVSVSENNEPPDKCEQEPREDEGKRKH*QRP 99 RK E KG+ + + WF RK + SV +P D +++ KRK + Sbjct: 398 RKLEQQLKGILETQEKDLWFEKIRKCKVKDDSVYIIYDPTDARFSNNLKEDIKRKCPKVA 457 Query: 98 APLGVHEGREDVLKVSAPAL 39 + + +ED LK++ P L Sbjct: 458 MHKRLGQSKEDFLKLNGPDL 477 >SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 28.7 bits (61), Expect = 1.3 Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Frame = -3 Query: 164 PPDKCEQEPREDE-GKRKH*QRPAPLG-VHEGREDVLKVSAPALSHPRAESCSPG 6 PP P ED + P P+G + EG + ++H R+ SCSPG Sbjct: 13 PPSPSSPTPYEDVLPLSETLSPPCPVGNIREGISKTIMSEKGTVTHRRSNSCSPG 67 >SB_42097| Best HMM Match : DUF1605 (HMM E-Value=3e-15) Length = 889 Score = 28.3 bits (60), Expect = 1.7 Identities = 17/63 (26%), Positives = 26/63 (41%), Gaps = 1/63 (1%) Frame = +2 Query: 53 IPSGHLH-DPRGRPVALDAASVCAFLHPLVALVRTYLVAHYFHSRRPHPNSTYGTERTTR 229 + GH DPRG + LHP + R+ ++ H+ + P P+ T GT Sbjct: 405 VKRGHYRTDPRGVNLNRVYLDPDPTLHPSIFAARSVILYHHNSNGNPPPSCTCGTTNGNT 464 Query: 230 SLP 238 P Sbjct: 465 ESP 467 >SB_37663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1735 Score = 27.9 bits (59), Expect = 2.3 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +2 Query: 23 RHEGG*AQAPIPSGHLHDPRGRP 91 RHE G A+AP PS P G+P Sbjct: 1547 RHEDGAAEAPSPSLRERKPEGKP 1569 >SB_21209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 390 Score = 27.9 bits (59), Expect = 2.3 Identities = 20/60 (33%), Positives = 31/60 (51%) Frame = -3 Query: 299 DGVLSFNRKEEAASKGVDVVEAGNGWFSLFRKWNWGEVSVSENNEPPDKCEQEPREDEGK 120 +G+L F +KEE K ++ E G S F KW + ++ +N+ + E E R EGK Sbjct: 131 EGIL-FEKKEEEELKKLEEYEKGGRDPSEFLKW---QETMRKNDMERELAEIEKRRLEGK 186 >SB_38188| Best HMM Match : rve (HMM E-Value=5.7e-31) Length = 836 Score = 27.5 bits (58), Expect = 3.0 Identities = 17/64 (26%), Positives = 29/64 (45%) Frame = +2 Query: 83 GRPVALDAASVCAFLHPLVALVRTYLVAHYFHSRRPHPNSTYGTERTTRSLPQQRQLLYW 262 G P L + + F+ +V ++ ++ H H R HP S E + + +R L + Sbjct: 236 GPPAILQSDNGGEFVGDVVKVLASHFNVHLVHGRPHHPQSQGQVENLNKQV--KRYLARF 293 Query: 263 LLPL 274 L PL Sbjct: 294 LQPL 297 >SB_1505| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 26.6 bits (56), Expect = 5.3 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = -1 Query: 187 SP*VKIMSHQISANKSHERMKESANTSSVQRHWAST 80 SP +K HQ + NK H+++ + + Q H +T Sbjct: 41 SPQLKTKQHQFTMNKLHQKVSKLQLSLDAQMHMQAT 76 >SB_59353| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 560 Score = 26.6 bits (56), Expect = 5.3 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -3 Query: 224 WFSLFRKWNWGEVSVSENNEPPDKCEQEPREDEGKRK 114 +F LF E+ V+E N+ +C + +DEG+RK Sbjct: 79 FFELFFNSEVIELIVTETNKYAVQCNPDEFDDEGRRK 115 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 26.2 bits (55), Expect = 7.0 Identities = 13/28 (46%), Positives = 16/28 (57%), Gaps = 4/28 (14%) Frame = -3 Query: 77 GREDVLKVSAPALSHP----RAESCSPG 6 GR L + P+LSHP + SCSPG Sbjct: 872 GRVKYLAATGPSLSHPFPLVTSNSCSPG 899 >SB_21415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 26.2 bits (55), Expect = 7.0 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -1 Query: 259 VKELTLLRQGTGGSLCSVSG 200 +KELTL G G +C+VSG Sbjct: 154 LKELTLQMYGEGNHVCNVSG 173 >SB_4588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 729 Score = 26.2 bits (55), Expect = 7.0 Identities = 18/63 (28%), Positives = 30/63 (47%) Frame = -3 Query: 233 GNGWFSLFRKWNWGEVSVSENNEPPDKCEQEPREDEGKRKH*QRPAPLGVHEGREDVLKV 54 G+G+ S R+ EV E ++ E+E RE +RK + AP G+E+ + Sbjct: 123 GSGYISSRRR---REVEKEEEERQREEEEEEERERARRRKDQEDNAPSRRRRGKEEEEEA 179 Query: 53 SAP 45 + P Sbjct: 180 TPP 182 >SB_57246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 737 Score = 26.2 bits (55), Expect = 7.0 Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 1/62 (1%) Frame = +2 Query: 62 GHLHDPRGRPVALDAASVCAFLHPL-VALVRTYLVAHYFHSRRPHPNSTYGTERTTRSLP 238 G + P+G A C +HPL + T+L++HY +P P+S+ T LP Sbjct: 443 GMMEPPKGGGDLPSNALKCLDIHPLPSSSTITFLLSHYL-PPQPLPSSSAITFLLNHYLP 501 Query: 239 QQ 244 Q Sbjct: 502 PQ 503 >SB_55820| Best HMM Match : WD40 (HMM E-Value=0.18) Length = 197 Score = 25.8 bits (54), Expect = 9.2 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -3 Query: 209 RKWNWGEVSVSENNEPPDKCEQEPREDEGKRK 114 R W+ + E+ +PP K E R DE K + Sbjct: 100 RVWDISCYYIKESEKPPPKENPEERSDEDKHR 131 >SB_53823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 665 Score = 25.8 bits (54), Expect = 9.2 Identities = 9/32 (28%), Positives = 19/32 (59%) Frame = -3 Query: 209 RKWNWGEVSVSENNEPPDKCEQEPREDEGKRK 114 +K +GE++ N + P +C++E D ++K Sbjct: 148 KKRAFGEINGGNNGQTPKRCKREALNDVPRKK 179 >SB_33207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 25.8 bits (54), Expect = 9.2 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +1 Query: 7 PGLQDSARGWLSAGADTFRTSSRPSWTPSGA 99 P L+D WL+ GAD + +W GA Sbjct: 46 PWLEDGVFTWLTDGADPWLEDGVVTWMTDGA 76 >SB_43621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1122 Score = 25.8 bits (54), Expect = 9.2 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +2 Query: 155 YLVAHYFHSRRPHPNSTYGTERTTR 229 YL +FH RRPH ++ E TR Sbjct: 901 YLTPVHFHKRRPHDAASACVEDPTR 925 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,284,880 Number of Sequences: 59808 Number of extensions: 230955 Number of successful extensions: 722 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 683 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 722 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 498218920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -