BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0580 (585 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 22 3.9 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 6.7 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 6.7 AY526236-1|AAS20469.1| 85|Apis mellifera epoxide hydrolase pro... 21 8.9 AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 21 8.9 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 22.2 bits (45), Expect = 3.9 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +2 Query: 482 STKEAQHHPIRHKHSH 529 ST HH + H HSH Sbjct: 410 STPGPHHHTMGHGHSH 425 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.4 bits (43), Expect = 6.7 Identities = 7/21 (33%), Positives = 11/21 (52%) Frame = -1 Query: 309 EVQPSGAGCGYTWAILQIWTS 247 ++ P G GY +L WT+ Sbjct: 92 KIAPIFKGIGYATCVLSCWTN 112 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.4 bits (43), Expect = 6.7 Identities = 7/21 (33%), Positives = 11/21 (52%) Frame = -1 Query: 309 EVQPSGAGCGYTWAILQIWTS 247 ++ P G GY +L WT+ Sbjct: 145 KIAPIFKGIGYATCVLSCWTN 165 >AY526236-1|AAS20469.1| 85|Apis mellifera epoxide hydrolase protein. Length = 85 Score = 21.0 bits (42), Expect = 8.9 Identities = 12/47 (25%), Positives = 20/47 (42%) Frame = -2 Query: 302 SLLALDADILGPSYKSGQVTSWLNALTNSKVLWPLLEERIHDLLGLN 162 S++A D +L P G + +L S + W + L+G N Sbjct: 7 SVIASDMAVLFPEKIIGLHNNMCTSLNLSNLFWLFVGTYFPSLIGAN 53 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 21.0 bits (42), Expect = 8.9 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -2 Query: 452 SSFPQPLFPGCFSLRPVFLQ 393 + FPQ FP C R FL+ Sbjct: 145 AKFPQEFFPECKWSRKGFLR 164 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 138,064 Number of Sequences: 438 Number of extensions: 2484 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16993167 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -