BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0576 (697 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1695 - 28775525-28776098,28776586-28776693,28777129-28777448 29 2.7 06_03_0510 - 21615724-21615909,21615992-21616075,21616164-216162... 29 3.5 01_06_0458 + 29531069-29531126,29531247-29531302,29531407-295315... 29 3.5 07_03_1180 - 24601631-24602142,24602518-24602581,24602811-246028... 29 4.7 02_05_0083 + 25684816-25685383,25685474-25685499,25686325-256867... 28 6.2 02_05_0491 + 29470575-29471351,29471574-29471806,29472697-294728... 28 8.1 >07_03_1695 - 28775525-28776098,28776586-28776693,28777129-28777448 Length = 333 Score = 29.5 bits (63), Expect = 2.7 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 2/50 (4%) Frame = +3 Query: 318 SFDNGITGAISS--SSEKLAIAGKLPLKPSCYSEISHPTGTLTGSSRTDY 461 SF N + +SS +SE A++ LPL S ++ P+ ++ GS+ DY Sbjct: 240 SFANCHSPVLSSECASEAAALSSSLPLSAVVGSAVTTPSTSIVGSAPADY 289 >06_03_0510 - 21615724-21615909,21615992-21616075,21616164-21616217, 21616324-21616371,21616529-21616611,21616963-21617113, 21617648-21617785,21617966-21618094,21618391-21618596, 21618734-21618845,21619145-21619204,21619331-21619429, 21619520-21619575,21620230-21620313,21621407-21621500 Length = 527 Score = 29.1 bits (62), Expect = 3.5 Identities = 22/68 (32%), Positives = 36/68 (52%) Frame = +3 Query: 381 KLPLKPSCYSEISHPTGTLTGSSRTDYPREHKWLI*VQQLHSRSRYKRPYRVPSLTHYLK 560 ++P+ +I+HPT LTG Y E + I +QLH+R Y +PSL+ +K Sbjct: 367 QIPILTMPNDDITHPTPDLTG-----YITEGQIYI-DRQLHNRQIYPPINVLPSLSRLMK 420 Query: 561 NAQKKRLT 584 +A + +T Sbjct: 421 SAIGEGMT 428 >01_06_0458 + 29531069-29531126,29531247-29531302,29531407-29531505, 29531989-29532048,29532285-29532396,29532459-29532694, 29533092-29533220,29533325-29533462,29534043-29534193, 29534394-29534476,29534658-29534705,29534828-29534881, 29534971-29535054,29535152-29535337 Length = 497 Score = 29.1 bits (62), Expect = 3.5 Identities = 22/68 (32%), Positives = 36/68 (52%) Frame = +3 Query: 381 KLPLKPSCYSEISHPTGTLTGSSRTDYPREHKWLI*VQQLHSRSRYKRPYRVPSLTHYLK 560 ++P+ +I+HPT LTG Y E + I +QLH+R Y +PSL+ +K Sbjct: 337 QIPILTMPNDDITHPTPDLTG-----YITEGQIYI-DRQLHNRQIYPPINVLPSLSRLMK 390 Query: 561 NAQKKRLT 584 +A + +T Sbjct: 391 SAIGEGMT 398 >07_03_1180 - 24601631-24602142,24602518-24602581,24602811-24602876, 24602949-24603070,24603170-24603344,24603466-24603701, 24603781-24604129,24605009-24605146,24605242-24605289 Length = 569 Score = 28.7 bits (61), Expect = 4.7 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +3 Query: 12 GTRASFNENSNRYYEESDSFNENSNRLVQ 98 G +++N N Y++ D +++N NR Q Sbjct: 477 GNGGGYHQNGNGYHQNGDGYHQNGNRYNQ 505 Score = 28.3 bits (60), Expect = 6.2 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +3 Query: 27 FNENSNRYYEESDSFNENSN 86 +N+N NRY++ D + +N N Sbjct: 503 YNQNGNRYHQNGDEYYQNGN 522 >02_05_0083 + 25684816-25685383,25685474-25685499,25686325-25686718, 25687726-25687814,25687924-25687980,25688341-25688408, 25688511-25688617,25688698-25688768,25688844-25688912 Length = 482 Score = 28.3 bits (60), Expect = 6.2 Identities = 11/27 (40%), Positives = 20/27 (74%), Gaps = 1/27 (3%) Frame = +3 Query: 45 RYYEES-DSFNENSNRLVQLLLGDNRH 122 +YYE++ D+F E + + V+ LLG+ +H Sbjct: 355 QYYEKAVDAFREGNQKEVEYLLGEGKH 381 >02_05_0491 + 29470575-29471351,29471574-29471806,29472697-29472856, 29473149-29473394,29473492-29473628,29473874-29474207, 29474283-29474444,29474717-29474791,29474866-29474966, 29475042-29475111,29475210-29475266,29475357-29475418, 29475505-29475577,29475663-29475884 Length = 902 Score = 27.9 bits (59), Expect = 8.1 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Frame = -3 Query: 596 R*TACQS--LLLCILQVVCE*WDSIGPLVPAARV*LLDSNEPLVFPWI 459 R TAC++ L L LQ + + WDS P +P RV + S V W+ Sbjct: 749 RPTACENARLYLAELQKIVKNWDSNKPWLPKKRVDEVVSEAEKVKTWL 796 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,483,648 Number of Sequences: 37544 Number of extensions: 352540 Number of successful extensions: 691 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 682 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 689 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1780264028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -