BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0572 (632 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 27 0.65 DQ396550-1|ABD60145.1| 113|Anopheles gambiae adipokinetic hormo... 25 2.6 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 26.6 bits (56), Expect = 0.65 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = -2 Query: 520 INLYSQNNASLKIYIYYFIRMYTIKIPLPLVN 425 +N S+ N L + Y+F ++TI++ L LV+ Sbjct: 879 LNANSERNQILNYFDYFFTSVFTIELLLKLVS 910 >DQ396550-1|ABD60145.1| 113|Anopheles gambiae adipokinetic hormone II protein. Length = 113 Score = 24.6 bits (51), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -1 Query: 422 NNLVKTY*VTHNLNHISLCTYICIIKSL 339 NNL VT N+ H++LC ++KSL Sbjct: 65 NNLCAA--VTKNIQHLTLCETRSLLKSL 90 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 562,122 Number of Sequences: 2352 Number of extensions: 11228 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 61886940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -