BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0571 (605 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 23 3.1 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 22 4.1 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 22 4.1 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 22 4.1 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 22 4.1 AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 21 7.1 AY526235-1|AAS20468.1| 169|Apis mellifera esterase protein. 21 7.1 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 21 7.1 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 22.6 bits (46), Expect = 3.1 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = -3 Query: 180 SVSSRTIPQSTPHGTYGTKYRYIYFSITNNCIRYY 76 S+S+RTI H KY Y + NNC + Y Sbjct: 84 SLSNRTI-----HNNNNYKYNYNNNNYNNNCKKLY 113 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.2 bits (45), Expect = 4.1 Identities = 9/30 (30%), Positives = 13/30 (43%) Frame = -3 Query: 165 TIPQSTPHGTYGTKYRYIYFSITNNCIRYY 76 ++ T H KY Y + NNC + Y Sbjct: 84 SLSNKTIHNNNNYKYNYNNNNYNNNCKKLY 113 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.2 bits (45), Expect = 4.1 Identities = 9/30 (30%), Positives = 13/30 (43%) Frame = -3 Query: 165 TIPQSTPHGTYGTKYRYIYFSITNNCIRYY 76 ++ T H KY Y + NNC + Y Sbjct: 84 SLSNKTIHNNNNYKYNYNNNNYNNNCKKLY 113 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.2 bits (45), Expect = 4.1 Identities = 9/30 (30%), Positives = 13/30 (43%) Frame = -3 Query: 165 TIPQSTPHGTYGTKYRYIYFSITNNCIRYY 76 ++ T H KY Y + NNC + Y Sbjct: 84 SLSNKTIHNNNNYKYNYNNNNYNNNCKKLY 113 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 22.2 bits (45), Expect = 4.1 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -1 Query: 458 PPDGEWLPSLMDVSNARG 405 PPD W P ++ +NA G Sbjct: 104 PPDKVWKPDIVLFNNADG 121 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 21.4 bits (43), Expect = 7.1 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -3 Query: 603 TLLSFVSGRVCIRTHYASPL 544 TL+ +G + HY SPL Sbjct: 204 TLIGLSAGGASVHYHYLSPL 223 >AY526235-1|AAS20468.1| 169|Apis mellifera esterase protein. Length = 169 Score = 21.4 bits (43), Expect = 7.1 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -3 Query: 603 TLLSFVSGRVCIRTHYASPL 544 TL+ +G + HY SPL Sbjct: 75 TLIGLSAGGASVHYHYLSPL 94 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 21.4 bits (43), Expect = 7.1 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -3 Query: 603 TLLSFVSGRVCIRTHYASPL 544 TL+ +G + HY SPL Sbjct: 204 TLIGLSAGGASVHYHYLSPL 223 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,111 Number of Sequences: 438 Number of extensions: 4893 Number of successful extensions: 11 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17848938 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -