BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0569 (699 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 30 0.016 EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B pro... 25 0.79 AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 22 5.5 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 30.3 bits (65), Expect = 0.016 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +2 Query: 230 TQLPSNGGTKPFTDGHLSVAPNPPP 304 T LPS+G T P D + VAP P P Sbjct: 70 TPLPSDGTTSPEPDPEIPVAPEPAP 94 >EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B protein. Length = 279 Score = 24.6 bits (51), Expect = 0.79 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 266 TDGHLSVAPNPPPRGPRVLGIHRVTMRPP 352 TD L NPP PR + R RPP Sbjct: 240 TDEQLKELENPPTPKPRPTKVSRRKPRPP 268 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 21.8 bits (44), Expect = 5.5 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +2 Query: 203 LRLVATYLDTQLPSNGGTKPFTDGHLSVAPNPPP 304 +R VA ++PS + P +SV+P PP Sbjct: 66 IRPVALPPKREIPSPKRSSPILAEKVSVSPTTPP 99 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,767 Number of Sequences: 336 Number of extensions: 3301 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -