BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0566 (617 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14527| Best HMM Match : SAP (HMM E-Value=1.6e-13) 28 7.0 SB_37209| Best HMM Match : Ion_trans (HMM E-Value=1.7e-05) 27 9.2 >SB_14527| Best HMM Match : SAP (HMM E-Value=1.6e-13) Length = 347 Score = 27.9 bits (59), Expect = 7.0 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -1 Query: 494 SVGQSEPVDINALKQNAKRF 435 S+ EP+D+N LK+ A+RF Sbjct: 94 SLSADEPIDVNKLKKRAERF 113 >SB_37209| Best HMM Match : Ion_trans (HMM E-Value=1.7e-05) Length = 822 Score = 27.5 bits (58), Expect = 9.2 Identities = 16/51 (31%), Positives = 25/51 (49%) Frame = +3 Query: 138 LYRLVFILISVIIFHLKAPVFKYRDCL*GIMDLIKTKIVLFFETRKGFIKF 290 LYR+ ++L VIIF + A ++ + L + IK V F F+ F Sbjct: 309 LYRIAYVLTQVIIFPVLAVIYFFMPFL-EVGRKIKRPFVKFINHTSSFVVF 358 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,342,961 Number of Sequences: 59808 Number of extensions: 326255 Number of successful extensions: 1241 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1198 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1241 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1524174750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -