BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0565 (671 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory recept... 23 1.7 AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory recept... 23 1.7 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 5.3 >AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory receptor candidate 53 protein. Length = 659 Score = 23.4 bits (48), Expect = 1.7 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = -1 Query: 662 HSFFMHFLRSKIIIFFKALAM 600 + FMH + +K+I F+K+ A+ Sbjct: 59 YHIFMHIVPTKLISFYKSTAI 79 >AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory receptor candidate 15 protein. Length = 455 Score = 23.4 bits (48), Expect = 1.7 Identities = 13/50 (26%), Positives = 25/50 (50%) Frame = +1 Query: 436 VSLSQSTIETENPSPQRRKEIMHTLTHVIVTFVLTDGQIRTYRLSISQFH 585 +S+ +S N S R+ + +H+ V + G + TY L++ Q+H Sbjct: 403 LSVFESCTRLNNES--RKPSFVIQFSHIPVDNIEFAGALVTYELTLFQYH 450 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 5.3 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 371 YNFSVHSNTDSSDVHSG 321 +NF++ SN D SD+ G Sbjct: 217 HNFNMISNDDESDIIQG 233 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,395 Number of Sequences: 336 Number of extensions: 3497 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17489640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -