Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NRPG0563
         (674 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A5KAE3 Cluster: Ferlin, putative; n=4; Plasmodium|Rep: ...    33   6.3  

>UniRef50_A5KAE3 Cluster: Ferlin, putative; n=4; Plasmodium|Rep:
           Ferlin, putative - Plasmodium vivax
          Length = 1696

 Score = 33.1 bits (72), Expect = 6.3
 Identities = 18/62 (29%), Positives = 29/62 (46%)
 Frame = -3

Query: 642 FYKSKIRSNYFRREFNRYVFWFEILKREIPSLAPTPAIDLNLKDYSFPVYKNYI*FEIQS 463
           F +S   SNY  + + R  F + +L  + P       +D + +DYS   Y N + F +  
Sbjct: 587 FNESDPLSNYKLKSYVRIPFKYLLLSEKRPKWFSMRNVDTSTQDYSISFYANLVPFHLFK 646

Query: 462 KR 457
           KR
Sbjct: 647 KR 648


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 580,705,859
Number of Sequences: 1657284
Number of extensions: 10359009
Number of successful extensions: 20349
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 19752
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 20348
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 52066120554
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)