BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0559 (644 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_1591| Best HMM Match : 7tm_1 (HMM E-Value=6.8e-06) 30 1.9 SB_47055| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 >SB_1591| Best HMM Match : 7tm_1 (HMM E-Value=6.8e-06) Length = 286 Score = 29.9 bits (64), Expect = 1.9 Identities = 19/67 (28%), Positives = 38/67 (56%) Frame = +1 Query: 196 NISVINLGNCRVLSLSQGLHLIVNLAIYS*LNELFKIILLQF*YYYINFKHHNITSML*K 375 N+ V ++ R + S H+++NLAI L L + ++ F +Y++F+++ + S+ Sbjct: 24 NLLVCSVVRSRTVRSSATNHILLNLAIADILGCLVNLPIM-FVTFYVDFQNNFLESLSDA 82 Query: 376 NFNLRVT 396 +F L VT Sbjct: 83 HFVLTVT 89 >SB_47055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 933 Score = 27.9 bits (59), Expect = 7.5 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 592 EFLSVEIVRYIVNKLYYRASILSCIKYNNQE 500 E + E+ +Y N LYY +L +YNN E Sbjct: 347 EHIITEVKKYSNNDLYYSPDVLIVNRYNNFE 377 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,804,206 Number of Sequences: 59808 Number of extensions: 212844 Number of successful extensions: 298 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 281 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 298 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1633044375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -