BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0559 (644 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF068717-2|AAC17763.1| 325|Caenorhabditis elegans Serpentine re... 28 4.9 >AF068717-2|AAC17763.1| 325|Caenorhabditis elegans Serpentine receptor, class h protein248 protein. Length = 325 Score = 28.3 bits (60), Expect = 4.9 Identities = 22/80 (27%), Positives = 41/80 (51%), Gaps = 4/80 (5%) Frame = +1 Query: 193 LNISVINLGNCRVLSLSQGL----HLIVNLAIYS*LNELFKIILLQF*YYYINFKHHNIT 360 LN++++N N VLSL+ L ++ + I S + F + L QF + K + + Sbjct: 170 LNLTLVNNRNLFVLSLNSNLVGYCAIMETVVIVSPIILFFFLTLYQFFKIRDSMKFSSKS 229 Query: 361 SML*KNFNLRVTIQTFFNVV 420 L K+F + +T+Q+ + V Sbjct: 230 YQLQKSFLIAITLQSLLSFV 249 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,066,160 Number of Sequences: 27780 Number of extensions: 187127 Number of successful extensions: 281 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 278 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 281 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1423653030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -