BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0557 (658 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ494419-1|ABF55370.1| 127|Apis mellifera telomerase reverse tr... 23 1.9 DQ494418-1|ABF55369.1| 110|Apis mellifera telomerase reverse tr... 23 1.9 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 23 3.4 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 22 5.9 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 21 7.8 >DQ494419-1|ABF55370.1| 127|Apis mellifera telomerase reverse transcriptase protein. Length = 127 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +2 Query: 434 KICLLRSQSGRYCTLIADVFEVFH 505 ++C+L Q+ R C LI D+F+ H Sbjct: 35 EVCVL--QANRACILIKDLFDNVH 56 >DQ494418-1|ABF55369.1| 110|Apis mellifera telomerase reverse transcriptase protein. Length = 110 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +2 Query: 434 KICLLRSQSGRYCTLIADVFEVFH 505 ++C+L Q+ R C LI D+F+ H Sbjct: 18 EVCVL--QANRACILIKDLFDNVH 39 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 22.6 bits (46), Expect = 3.4 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +3 Query: 87 NTSGLSIGKIYLLVYNAAQTLGWSYMLWQSLVHFL 191 NTS +S+ K + + +GWS L SLV+ + Sbjct: 377 NTSLVSLDKKQYTWRHTSVLIGWSAFLCISLVYII 411 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.8 bits (44), Expect = 5.9 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = +1 Query: 199 LWMLFGVRSSGLSLY 243 +W+ FG R L LY Sbjct: 1002 VWLFFGCRQRNLDLY 1016 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +1 Query: 328 IQECFWYVELYWQHKERLQV 387 IQ C Y+E + HK++L++ Sbjct: 127 IQICPIYIESFSYHKQKLRL 146 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 188,017 Number of Sequences: 438 Number of extensions: 4043 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19734030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -