BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0556 (706 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_1138 + 30684014-30684386,30684480-30684865,30684870-306849... 28 6.3 01_05_0513 - 22864657-22867899 28 6.3 >03_05_1138 + 30684014-30684386,30684480-30684865,30684870-30684962, 30684963-30685108,30685211-30685454,30685562-30685666, 30685774-30685956,30686052-30686738 Length = 738 Score = 28.3 bits (60), Expect = 6.3 Identities = 15/46 (32%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +1 Query: 76 WHAFVRKRTKP-IPEDKAILWKRRLSFAYALFAWNAFGLVVYSAYK 210 WHA VR+R P + + + + A L W A+G Y YK Sbjct: 35 WHAQVRRRLLPLLRRQRMAVLAAPVVAAVLLLTWAAYGEAQYVLYK 80 >01_05_0513 - 22864657-22867899 Length = 1080 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +1 Query: 91 RKRTKPIPEDKAILWKRRLSFA 156 RKRT+ +P D + W RL FA Sbjct: 58 RKRTRTVPRDLSPQWHERLEFA 79 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,852,347 Number of Sequences: 37544 Number of extensions: 323971 Number of successful extensions: 617 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 608 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 617 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1815633512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -