BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0553 (649 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59334| Best HMM Match : zf-AN1 (HMM E-Value=0.72) 30 1.9 SB_11212| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_35352| Best HMM Match : zf-C2H2 (HMM E-Value=0.0016) 27 9.9 SB_31530| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 >SB_59334| Best HMM Match : zf-AN1 (HMM E-Value=0.72) Length = 1161 Score = 29.9 bits (64), Expect = 1.9 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +3 Query: 420 EIYEGFLAGQN*TCYKCLRWY 482 +I +G L GQ C++CLRW+ Sbjct: 117 DINDGSLCGQTQCCHRCLRWW 137 >SB_11212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1175 Score = 29.9 bits (64), Expect = 1.9 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +3 Query: 420 EIYEGFLAGQN*TCYKCLRWY 482 +I +G L GQ C++CLRW+ Sbjct: 838 DINDGSLCGQTQCCHRCLRWW 858 >SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6489 Score = 28.3 bits (60), Expect = 5.7 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +3 Query: 363 EADYWEQMKAKYDPKDEFKEIY-EGFLAG 446 +AD W + A YD +D F +IY G L G Sbjct: 5963 DADEWYHVAATYDSRDRFAKIYINGELKG 5991 >SB_35352| Best HMM Match : zf-C2H2 (HMM E-Value=0.0016) Length = 221 Score = 27.5 bits (58), Expect = 9.9 Identities = 16/62 (25%), Positives = 28/62 (45%), Gaps = 1/62 (1%) Frame = +3 Query: 228 DEGRCTPDGKELKAHIKDGMQTACAKCTDKQKVSARKIVKHIKQHEADYWEQMKAKYD-P 404 D +C+ DG+ + +K Q A K + +K R++ + E + K K+D P Sbjct: 95 DVAKCSQDGEGVVGPLKQLQQLAGGKASSTKKHQERQVAMVVNLSEVCNGVEAKPKHDSP 154 Query: 405 KD 410 D Sbjct: 155 MD 156 >SB_31530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 661 Score = 27.5 bits (58), Expect = 9.9 Identities = 24/107 (22%), Positives = 43/107 (40%) Frame = +3 Query: 165 IDVDEILENRKLLVPYIKCVLDEGRCTPDGKELKAHIKDGMQTACAKCTDKQKVSARKIV 344 + D LE+ + PY C+ ++ G + ++ Q AK K+ S + Sbjct: 541 VPCDRKLESAFAINPYPTCLYEKALAVRLGLR-DSRVQVWFQNRRAK--SKRNRSGCQSS 597 Query: 345 KHIKQHEADYWEQMKAKYDPKDEFKEIYEGFLAGQN*TCYKCLRWYN 485 + Q+E DY+ + Y PK+ G+ CY+ L Y+ Sbjct: 598 TYRGQNEGDYFSPTASDYSPKNSEYHTNTSDCFGEARECYEELSTYD 644 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,796,535 Number of Sequences: 59808 Number of extensions: 377014 Number of successful extensions: 920 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 855 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 918 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1645141000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -