BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0546 (594 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0028 - 22243272-22243577,22244564-22244713,22244919-222456... 28 6.5 >04_04_0028 - 22243272-22243577,22244564-22244713,22244919-22245656, 22247233-22247331,22247541-22247933,22248806-22248961 Length = 613 Score = 27.9 bits (59), Expect = 6.5 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = -1 Query: 501 IRWTNLH*TPPGVQNLWFPGSCPPSHCSNVGGSLDDIFTVRTRAVSNRLRT 349 + W+ L Q+L FPG CP C+ + L +RT +S++ R+ Sbjct: 194 VHWSLLGVRRTAFQHLAFPGCCPDLICT-ILSKLPQKEAIRTSVLSSKWRS 243 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,369,438 Number of Sequences: 37544 Number of extensions: 367393 Number of successful extensions: 891 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 876 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 891 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1411925004 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -