BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0544 (585 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25764| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_59334| Best HMM Match : zf-AN1 (HMM E-Value=0.72) 30 1.6 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_11212| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_55485| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_14889| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_56020| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_10991| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_50847| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_37251| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_35352| Best HMM Match : zf-C2H2 (HMM E-Value=0.0016) 27 8.5 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 27 8.5 SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_49504| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_42068| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_31530| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_31130| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_14396| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_13739| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 27 8.5 >SB_25764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -3 Query: 43 ASCLVPNSCSPGDP 2 ASC NSCSPGDP Sbjct: 7 ASCFASNSCSPGDP 20 >SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = -3 Query: 61 LRFSVLASCLVPNSCSPGDP 2 LRFS+ + + NSCSPGDP Sbjct: 14 LRFSIFWTDRLSNSCSPGDP 33 >SB_59334| Best HMM Match : zf-AN1 (HMM E-Value=0.72) Length = 1161 Score = 29.9 bits (64), Expect = 1.6 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +1 Query: 448 EIYEGFLAGQN*TCYKCLRWY 510 +I +G L GQ C++CLRW+ Sbjct: 117 DINDGSLCGQTQCCHRCLRWW 137 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 29.9 bits (64), Expect = 1.6 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 37 CLVPNSCSPGDP 2 CL+ NSCSPGDP Sbjct: 69 CLISNSCSPGDP 80 >SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.9 bits (64), Expect = 1.6 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -3 Query: 52 SVLASCLVPNSCSPGDP 2 +++ C V NSCSPGDP Sbjct: 27 NIICICTVSNSCSPGDP 43 >SB_11212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1175 Score = 29.9 bits (64), Expect = 1.6 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +1 Query: 448 EIYEGFLAGQN*TCYKCLRWY 510 +I +G L GQ C++CLRW+ Sbjct: 838 DINDGSLCGQTQCCHRCLRWW 858 >SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -3 Query: 70 DT*LRFSVLASCLVPNSCSPGDP 2 DT + ++++ V NSCSPGDP Sbjct: 6 DTLISANIISIAFVSNSCSPGDP 28 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 29.1 bits (62), Expect = 2.8 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -3 Query: 55 FSVLASCLVPNSCSPGDP 2 F L S L+ NSCSPGDP Sbjct: 10 FVELISFLISNSCSPGDP 27 >SB_55485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 28.7 bits (61), Expect = 3.7 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = -2 Query: 125 VRHFMSAMVLINTKAMSPRHLTQIQCTCQLPRAEFLQPGGS 3 ++HF ++ N K + +IQ P EFLQPGGS Sbjct: 1 MKHFTDTLISANIKIIFQEADQEIQYN---PEIEFLQPGGS 38 >SB_14889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 28.7 bits (61), Expect = 3.7 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = -2 Query: 125 VRHFMSAMVLINTKAMSPRHLTQIQCTCQLPRAEFLQPGGS 3 ++HF LI+ +S H +C+C EFLQPGGS Sbjct: 1 MKHFTDT--LISANIVSIEHTEHKRCSC----IEFLQPGGS 35 >SB_56020| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 309 Score = 28.3 bits (60), Expect = 4.9 Identities = 22/67 (32%), Positives = 33/67 (49%), Gaps = 4/67 (5%) Frame = -3 Query: 580 KYGSNLQTKSHL----*CLTKKKQLFCCTTASIYNKFSFDQRGIPRRFL*IHLWDHIWPS 413 KYG L T+SHL +++K+ + T S N FS G R L W+ I+ S Sbjct: 95 KYGHRLTTRSHLSEFIPLISEKENMLIKTEISASNGFSVIFDGSTRLVLETRYWNTIF-S 153 Query: 412 SAPSNQL 392 +P+ +L Sbjct: 154 HSPAARL 160 >SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 28.3 bits (60), Expect = 4.9 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = +1 Query: 1 VDPPGCRNSARGS 39 VDPPGCRNS GS Sbjct: 16 VDPPGCRNSMIGS 28 >SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6489 Score = 28.3 bits (60), Expect = 4.9 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +1 Query: 391 EADYWEQMKAKYDPKDEFKEIY-EGFLAG 474 +AD W + A YD +D F +IY G L G Sbjct: 5963 DADEWYHVAATYDSRDRFAKIYINGELKG 5991 >SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 28.3 bits (60), Expect = 4.9 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -3 Query: 49 VLASCLVPNSCSPGDP 2 V +C+ NSCSPGDP Sbjct: 14 VQGNCMKSNSCSPGDP 29 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 28.3 bits (60), Expect = 4.9 Identities = 15/24 (62%), Positives = 16/24 (66%), Gaps = 4/24 (16%) Frame = -3 Query: 61 LRFSVLA----SCLVPNSCSPGDP 2 +R SVLA LV NSCSPGDP Sbjct: 13 IRISVLALKSRPMLVSNSCSPGDP 36 >SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 28.3 bits (60), Expect = 4.9 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -3 Query: 46 LASCLVPNSCSPGDP 2 L+S L+ NSCSPGDP Sbjct: 3 LSSFLLSNSCSPGDP 17 >SB_10991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 4.9 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = -2 Query: 125 VRHFMSAMVLINTKAMSPRH--LTQIQCTCQLPRAEFLQPGGS 3 ++HF ++ N + + H L+ C EFLQPGGS Sbjct: 1 MKHFTDTLISANIELIEVCHQKLSDFTYYCCATHIEFLQPGGS 43 >SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 28.3 bits (60), Expect = 4.9 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = -3 Query: 37 CLVPNSCSPGDP 2 C V NSCSPGDP Sbjct: 25 CYVSNSCSPGDP 36 >SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 28.3 bits (60), Expect = 4.9 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -3 Query: 46 LASCLVPNSCSPGDP 2 L S ++ NSCSPGDP Sbjct: 22 LGSLIISNSCSPGDP 36 >SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 27.9 bits (59), Expect = 6.4 Identities = 12/15 (80%), Positives = 12/15 (80%), Gaps = 1/15 (6%) Frame = -3 Query: 43 ASCLVP-NSCSPGDP 2 A C VP NSCSPGDP Sbjct: 51 AHCRVPSNSCSPGDP 65 >SB_50847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 27.9 bits (59), Expect = 6.4 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 5/46 (10%) Frame = -2 Query: 125 VRHFMSAMVLINTKAMSPRHLTQIQCTCQ-----LPRAEFLQPGGS 3 ++HF ++ N K ++P + I T Q + EFLQPGGS Sbjct: 1 MKHFTDTLISANIKCLAPFGKSSIITTEQVVILYITIIEFLQPGGS 46 >SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 27.9 bits (59), Expect = 6.4 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = +1 Query: 1 VDPPGCRNSARG 36 VDPPGCRNS G Sbjct: 16 VDPPGCRNSIEG 27 >SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 27.9 bits (59), Expect = 6.4 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +1 Query: 1 VDPPGCRNSARGS 39 VDPPGCRNS R + Sbjct: 16 VDPPGCRNSIRST 28 >SB_37251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 27.9 bits (59), Expect = 6.4 Identities = 15/29 (51%), Positives = 17/29 (58%), Gaps = 2/29 (6%) Frame = -2 Query: 83 AMSPRHLTQIQCTCQLP--RAEFLQPGGS 3 A SPRH T + Q + EFLQPGGS Sbjct: 7 APSPRHSTYLSLHAQSSSLQIEFLQPGGS 35 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.5 bits (58), Expect = 8.5 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -3 Query: 52 SVLASCLVPNSCSPGDP 2 S ++ L+ NSCSPGDP Sbjct: 27 STVSISLISNSCSPGDP 43 >SB_35352| Best HMM Match : zf-C2H2 (HMM E-Value=0.0016) Length = 221 Score = 27.5 bits (58), Expect = 8.5 Identities = 16/62 (25%), Positives = 28/62 (45%), Gaps = 1/62 (1%) Frame = +1 Query: 256 DEGRCTPDGKELKAHIKDGMQTACAKCTDKQKVSARKIVKHIKQHEADYWEQMKAKYD-P 432 D +C+ DG+ + +K Q A K + +K R++ + E + K K+D P Sbjct: 95 DVAKCSQDGEGVVGPLKQLQQLAGGKASSTKKHQERQVAMVVNLSEVCNGVEAKPKHDSP 154 Query: 433 KD 438 D Sbjct: 155 MD 156 >SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) Length = 183 Score = 27.5 bits (58), Expect = 8.5 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = +1 Query: 1 VDPPGCRNSAR 33 VDPPGCRNS R Sbjct: 16 VDPPGCRNSIR 26 >SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.5 bits (58), Expect = 8.5 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = -3 Query: 37 CLVPNSCSPGDP 2 CL NSCSPGDP Sbjct: 13 CLRSNSCSPGDP 24 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.5 bits (58), Expect = 8.5 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -3 Query: 52 SVLASCLVPNSCSPGDP 2 S ++ L+ NSCSPGDP Sbjct: 27 STVSISLISNSCSPGDP 43 >SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.5 bits (58), Expect = 8.5 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -3 Query: 58 RFSVLASCLVPNSCSPGDP 2 RF V+ + NSCSPGDP Sbjct: 16 RFRVIIAVRRSNSCSPGDP 34 >SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.5 bits (58), Expect = 8.5 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -3 Query: 49 VLASCLVPNSCSPGDP 2 + A+ ++ NSCSPGDP Sbjct: 9 ISANIIISNSCSPGDP 24 >SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 27.5 bits (58), Expect = 8.5 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = -3 Query: 40 SCLVPNSCSPGDP 2 +C + NSCSPGDP Sbjct: 8 TCALSNSCSPGDP 20 >SB_49504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.5 bits (58), Expect = 8.5 Identities = 13/17 (76%), Positives = 13/17 (76%), Gaps = 2/17 (11%) Frame = -2 Query: 47 TCQLP--RAEFLQPGGS 3 TC LP R EFLQPGGS Sbjct: 8 TCALPQDRIEFLQPGGS 24 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.5 bits (58), Expect = 8.5 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -3 Query: 52 SVLASCLVPNSCSPGDP 2 S ++ L+ NSCSPGDP Sbjct: 27 STVSISLISNSCSPGDP 43 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 27.5 bits (58), Expect = 8.5 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +1 Query: 1 VDPPGCRNSARGS 39 VDPPGCRNS G+ Sbjct: 33 VDPPGCRNSIDGN 45 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.5 bits (58), Expect = 8.5 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -3 Query: 52 SVLASCLVPNSCSPGDP 2 S ++ L+ NSCSPGDP Sbjct: 27 STVSISLISNSCSPGDP 43 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.5 bits (58), Expect = 8.5 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -3 Query: 52 SVLASCLVPNSCSPGDP 2 S ++ L+ NSCSPGDP Sbjct: 27 STVSISLISNSCSPGDP 43 >SB_42068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3367 Score = 27.5 bits (58), Expect = 8.5 Identities = 13/39 (33%), Positives = 23/39 (58%) Frame = +2 Query: 47 YTESESSVWVTSLLC*LKPLQT*SV*QLLHFYSWRAYRL 163 Y+ E S WV + ++PL++ S+ QL+ ++ A RL Sbjct: 2737 YSPREMSRWVRGICEAMRPLESMSIEQLVRIWAHEALRL 2775 >SB_31530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 661 Score = 27.5 bits (58), Expect = 8.5 Identities = 24/107 (22%), Positives = 43/107 (40%) Frame = +1 Query: 193 IDVDEILENRKLLVPYIKCVLDEGRCTPDGKELKAHIKDGMQTACAKCTDKQKVSARKIV 372 + D LE+ + PY C+ ++ G + ++ Q AK K+ S + Sbjct: 541 VPCDRKLESAFAINPYPTCLYEKALAVRLGLR-DSRVQVWFQNRRAK--SKRNRSGCQSS 597 Query: 373 KHIKQHEADYWEQMKAKYDPKDEFKEIYEGFLAGQN*TCYKCLRWYN 513 + Q+E DY+ + Y PK+ G+ CY+ L Y+ Sbjct: 598 TYRGQNEGDYFSPTASDYSPKNSEYHTNTSDCFGEARECYEELSTYD 644 >SB_31130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.5 bits (58), Expect = 8.5 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -3 Query: 46 LASCLVPNSCSPGDP 2 +++C NSCSPGDP Sbjct: 3 ISTCEASNSCSPGDP 17 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.5 bits (58), Expect = 8.5 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -3 Query: 52 SVLASCLVPNSCSPGDP 2 S ++ L+ NSCSPGDP Sbjct: 27 STVSISLISNSCSPGDP 43 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 27.5 bits (58), Expect = 8.5 Identities = 12/21 (57%), Positives = 17/21 (80%), Gaps = 2/21 (9%) Frame = -3 Query: 58 RFSVLA--SCLVPNSCSPGDP 2 R+++L+ + LV NSCSPGDP Sbjct: 16 RYAILSPRARLVSNSCSPGDP 36 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 27.5 bits (58), Expect = 8.5 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -3 Query: 52 SVLASCLVPNSCSPGDP 2 S ++ L+ NSCSPGDP Sbjct: 28 STVSISLISNSCSPGDP 44 >SB_14396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.5 bits (58), Expect = 8.5 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -3 Query: 70 DT*LRFSVLASCLVPNSCSPGDP 2 DT + +++ S + NSCSPGDP Sbjct: 6 DTLISANIVLSRVSSNSCSPGDP 28 >SB_13739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.5 bits (58), Expect = 8.5 Identities = 17/33 (51%), Positives = 18/33 (54%), Gaps = 3/33 (9%) Frame = -2 Query: 92 NTKAMSPRHLTQIQCTCQL---PRAEFLQPGGS 3 N KA S +I CT L P EFLQPGGS Sbjct: 11 NPKAPSTDISERICCTTLLQGYPNIEFLQPGGS 43 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 27.5 bits (58), Expect = 8.5 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = +1 Query: 1 VDPPGCRNSARG 36 VDPPGCRNS G Sbjct: 92 VDPPGCRNSIAG 103 >SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.5 bits (58), Expect = 8.5 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -3 Query: 70 DT*LRFSVLASCLVPNSCSPGDP 2 DT + ++ C NSCSPGDP Sbjct: 6 DTLISANIENKCCRSNSCSPGDP 28 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.5 bits (58), Expect = 8.5 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -3 Query: 52 SVLASCLVPNSCSPGDP 2 S ++ L+ NSCSPGDP Sbjct: 27 STVSISLISNSCSPGDP 43 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 27.5 bits (58), Expect = 8.5 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -3 Query: 52 SVLASCLVPNSCSPGDP 2 S ++ L+ NSCSPGDP Sbjct: 25 STVSISLISNSCSPGDP 41 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 27.5 bits (58), Expect = 8.5 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = +1 Query: 1 VDPPGCRNSARG 36 VDPPGCRNS G Sbjct: 103 VDPPGCRNSITG 114 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,082,399 Number of Sequences: 59808 Number of extensions: 378798 Number of successful extensions: 2415 Number of sequences better than 10.0: 50 Number of HSP's better than 10.0 without gapping: 2352 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2413 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1410146228 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -