BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0543 (636 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U02964-1|AAA03444.1| 376|Anopheles gambiae actin 1D protein. 24 3.5 U02933-1|AAA56882.1| 376|Anopheles gambiae actin 1D protein. 24 3.5 U02930-1|AAA56881.1| 376|Anopheles gambiae actin 1D protein. 24 3.5 CR954256-1|CAJ14142.1| 376|Anopheles gambiae actin protein. 23 6.1 AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh... 23 8.1 >U02964-1|AAA03444.1| 376|Anopheles gambiae actin 1D protein. Length = 376 Score = 24.2 bits (50), Expect = 3.5 Identities = 12/41 (29%), Positives = 17/41 (41%) Frame = -1 Query: 225 NFTSDESASKNSFKPKNYRLILVIKFNWTR*QIFWVETCYN 103 ++ DE+ SK Y + I NW + W T YN Sbjct: 53 SYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYN 93 >U02933-1|AAA56882.1| 376|Anopheles gambiae actin 1D protein. Length = 376 Score = 24.2 bits (50), Expect = 3.5 Identities = 12/41 (29%), Positives = 17/41 (41%) Frame = -1 Query: 225 NFTSDESASKNSFKPKNYRLILVIKFNWTR*QIFWVETCYN 103 ++ DE+ SK Y + I NW + W T YN Sbjct: 53 SYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYN 93 >U02930-1|AAA56881.1| 376|Anopheles gambiae actin 1D protein. Length = 376 Score = 24.2 bits (50), Expect = 3.5 Identities = 12/41 (29%), Positives = 17/41 (41%) Frame = -1 Query: 225 NFTSDESASKNSFKPKNYRLILVIKFNWTR*QIFWVETCYN 103 ++ DE+ SK Y + I NW + W T YN Sbjct: 53 SYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYN 93 >CR954256-1|CAJ14142.1| 376|Anopheles gambiae actin protein. Length = 376 Score = 23.4 bits (48), Expect = 6.1 Identities = 12/40 (30%), Positives = 16/40 (40%) Frame = -1 Query: 222 FTSDESASKNSFKPKNYRLILVIKFNWTR*QIFWVETCYN 103 + DE+ SK Y + I NW + W T YN Sbjct: 54 YVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYN 93 >AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion protein protein. Length = 1881 Score = 23.0 bits (47), Expect = 8.1 Identities = 13/37 (35%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = -3 Query: 361 QSDNQTK*CKAQKPI-CSHNIQTTSAHYVKCTGCIVN 254 + D + K Q+P HNIQ+ +GCIVN Sbjct: 1615 REDQRVKFILRQRPSEIRHNIQSFREILSNVSGCIVN 1651 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 611,485 Number of Sequences: 2352 Number of extensions: 11930 Number of successful extensions: 60 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 60 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 60 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62305095 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -