BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0541 (683 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 25 1.7 AY745219-1|AAU93486.1| 104|Anopheles gambiae cytochrome P450 pr... 25 2.9 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 654 HCFSLLPRITPYVHSVSS 601 H LLPR+ P HS+SS Sbjct: 446 HVCELLPRLQPRYHSISS 463 >AY745219-1|AAU93486.1| 104|Anopheles gambiae cytochrome P450 protein. Length = 104 Score = 24.6 bits (51), Expect = 2.9 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = +1 Query: 88 PEHPRKLIPELCNQFYHLGWVTGTGGGISIKQGDKIYIA 204 P HP L+ E F G I +K GDK+Y++ Sbjct: 25 PSHPL-LVRECTKPFTIPATENGDRAAIPLKVGDKLYVS 62 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 702,498 Number of Sequences: 2352 Number of extensions: 15761 Number of successful extensions: 31 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68995575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -