BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0541 (683 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF393493-1|AAL60418.1| 142|Apis mellifera odorant binding prote... 24 1.2 AF166497-1|AAD51945.1| 142|Apis mellifera putative odorant-bind... 24 1.2 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 22 6.3 >AF393493-1|AAL60418.1| 142|Apis mellifera odorant binding protein ASP2 protein. Length = 142 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/42 (23%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = +1 Query: 442 MIKGI-KDTSLGRYLRYDEKLVVPIIENTPFEKDLAGSLEEA 564 +++GI +DT + +Y+ Y ++P + +D+A +++ A Sbjct: 16 VVRGIDQDTVVAKYMEYLMPDIMPCADELHISEDIATNIQAA 57 >AF166497-1|AAD51945.1| 142|Apis mellifera putative odorant-binding protein ASP2 protein. Length = 142 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/42 (23%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = +1 Query: 442 MIKGI-KDTSLGRYLRYDEKLVVPIIENTPFEKDLAGSLEEA 564 +++GI +DT + +Y+ Y ++P + +D+A +++ A Sbjct: 16 VVRGIDQDTVVAKYMEYLMPDIMPCADELHISEDIATNIQAA 57 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.8 bits (44), Expect = 6.3 Identities = 11/40 (27%), Positives = 17/40 (42%) Frame = +1 Query: 562 ALKEYPGTSAVLVRRHGVYVWGDTWQQAKTMTECYDYLFE 681 A KE G L++ + +TW+ + C D L E Sbjct: 251 AKKEIKGVPTYLIKWKNWDLKYNTWEPISNLINCSDILEE 290 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,733 Number of Sequences: 438 Number of extensions: 4114 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20830365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -