BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0538 (617 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0107 - 13470054-13470126,13471723-13471851,13472000-134720... 30 1.7 09_04_0575 - 18654887-18655047,18656182-18656242,18656777-18657250 27 9.0 >07_03_0107 - 13470054-13470126,13471723-13471851,13472000-13472086, 13472480-13472524,13473121-13473240,13474010-13474086, 13474319-13474407,13474620-13474693,13475177-13475243, 13476427-13476478,13477272-13477307 Length = 282 Score = 29.9 bits (64), Expect = 1.7 Identities = 14/52 (26%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = +1 Query: 136 SGIIHIRERQRTSRGPLASLP-SMTWWIEYILFNTVKLLFVKVDLIKSCSIE 288 SG +H E T +++L + W++ YI+F +KL + +I++ +E Sbjct: 196 SGSVHGNEISLTCESEVSNLRYTHPWYLRYIMFQALKLKVAFIQVIQTMDLE 247 >09_04_0575 - 18654887-18655047,18656182-18656242,18656777-18657250 Length = 231 Score = 27.5 bits (58), Expect = 9.0 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +2 Query: 422 VKCTPHLK*WHCLMFILMRGWRNIDTQTKTVLIEKCTYF 538 + CTP L ++ + + I T T TV+IE YF Sbjct: 139 INCTPELTGFYAKCGFVEKNVEKISTFTSTVVIELSVYF 177 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,536,686 Number of Sequences: 37544 Number of extensions: 289011 Number of successful extensions: 540 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 534 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 540 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1490248872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -