BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0538 (617 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57183| Best HMM Match : 7tm_1 (HMM E-Value=3.1e-08) 32 0.43 SB_29775| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_47055| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 >SB_57183| Best HMM Match : 7tm_1 (HMM E-Value=3.1e-08) Length = 533 Score = 31.9 bits (69), Expect = 0.43 Identities = 17/54 (31%), Positives = 28/54 (51%) Frame = +3 Query: 51 YLARIYDLLIAVICTLVLPVNYDTGFQRLWHYPYP*ATKNVTWTTSFSAFNDLV 212 ++ I +L IA I L+L V +D+G+ +PY A + W +AF +V Sbjct: 59 FIRLIQNLAIADIALLLLAVPFDSGWWAPEDFPYGGAMCKIIWPLKTAAFQAIV 112 >SB_29775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 547 Score = 30.7 bits (66), Expect = 0.99 Identities = 17/73 (23%), Positives = 36/73 (49%), Gaps = 6/73 (8%) Frame = +1 Query: 118 IQDFSGSGIIHIRERQRTSRGPLASLPSMTWWIEYILFNTVKLLFVKVDLIKSC------ 279 I+D G+G+I ++ RGP + WW+ + + ++++ L + + ++C Sbjct: 111 IRDLGGAGVIALKP---VMRGPDINDDGSVWWVSHEMVDSLRSLLTEWEFSEACHPYTSG 167 Query: 280 SIELHLKTNESRI 318 + HL+ NE I Sbjct: 168 RVGQHLEQNEGWI 180 >SB_47055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 933 Score = 28.7 bits (61), Expect = 4.0 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -1 Query: 200 EGREASGPRDVLCRSRIWIMPEPLKSCIIV 111 +G E GPR C + +W P P+ +C+ V Sbjct: 648 QGYELRGPRYTTCENTVWSQPAPV-ACVRV 676 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,878,258 Number of Sequences: 59808 Number of extensions: 366099 Number of successful extensions: 948 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 798 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 936 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1524174750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -