BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0538 (617 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY226540-1|AAO47366.1| 573|Drosophila melanogaster pickpocket 7... 30 2.2 AE014134-1078|AAF52370.2| 573|Drosophila melanogaster CG9499-PA... 30 2.2 >AY226540-1|AAO47366.1| 573|Drosophila melanogaster pickpocket 7 protein. Length = 573 Score = 30.3 bits (65), Expect = 2.2 Identities = 21/75 (28%), Positives = 33/75 (44%), Gaps = 3/75 (4%) Frame = -1 Query: 383 CCWNLL---GGYCHTRMTIFLWRAQIRDSFVFKCNSIEQLFIRSTFTNNNLTVLNRMYSI 213 C +LL G Y R L A+ D ++ N E+ F+R+ F + YS+ Sbjct: 362 CTMDLLFPPGQYRSCRAQDLLCLAEHNDLLIYSHNPGEKEFVRNQFQGMSCKCFRNCYSL 421 Query: 212 HQVIEGREASGPRDV 168 + + + R A P DV Sbjct: 422 NYISDVRPAFLPPDV 436 >AE014134-1078|AAF52370.2| 573|Drosophila melanogaster CG9499-PA protein. Length = 573 Score = 30.3 bits (65), Expect = 2.2 Identities = 21/75 (28%), Positives = 33/75 (44%), Gaps = 3/75 (4%) Frame = -1 Query: 383 CCWNLL---GGYCHTRMTIFLWRAQIRDSFVFKCNSIEQLFIRSTFTNNNLTVLNRMYSI 213 C +LL G Y R L A+ D ++ N E+ F+R+ F + YS+ Sbjct: 362 CTMDLLFPPGQYRSCRAQDLLCLAEHNDLLIYSHNPGEKEFVRNQFQGMSCKCFRNCYSL 421 Query: 212 HQVIEGREASGPRDV 168 + + + R A P DV Sbjct: 422 NYISDVRPAFLPPDV 436 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,915,884 Number of Sequences: 53049 Number of extensions: 530634 Number of successful extensions: 1056 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1026 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1051 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2538517050 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -