BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0538 (617 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68113-1|CAA92151.1| 321|Caenorhabditis elegans Hypothetical pr... 29 3.5 AF106575-5|AAC78171.1| 421|Caenorhabditis elegans Hypothetical ... 27 8.1 AF016446-8|AAC24168.2| 345|Caenorhabditis elegans Seven tm rece... 27 8.1 AC024830-9|ABQ13052.1| 1594|Caenorhabditis elegans Hypothetical ... 27 8.1 >Z68113-1|CAA92151.1| 321|Caenorhabditis elegans Hypothetical protein E03G2.1 protein. Length = 321 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +2 Query: 527 CTYFHIYVCMYIYTLRVFI 583 C Y +IY+ +Y+Y L +FI Sbjct: 83 CAYIYIYIYIYVYGLYIFI 101 >AF106575-5|AAC78171.1| 421|Caenorhabditis elegans Hypothetical protein K04F1.12 protein. Length = 421 Score = 27.5 bits (58), Expect = 8.1 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = -1 Query: 311 DSFVFKCNSIEQLFIRSTFTNNNLTVLNRMYSIHQVIEGRE 189 + V K NS+E +F T N NLT ++ + + ++ +E Sbjct: 291 EEHVQKLNSVESIFGSLTIDNTNLTSIDFLSKLKNIVSLKE 331 >AF016446-8|AAC24168.2| 345|Caenorhabditis elegans Seven tm receptor protein 205 protein. Length = 345 Score = 27.5 bits (58), Expect = 8.1 Identities = 13/29 (44%), Positives = 22/29 (75%) Frame = +3 Query: 42 LGIYLARIYDLLIAVICTLVLPVNYDTGF 128 L IY++ I ++L A++ LVLP+ ++TGF Sbjct: 45 LMIYIS-ILEVLYAIVDILVLPIFHNTGF 72 >AC024830-9|ABQ13052.1| 1594|Caenorhabditis elegans Hypothetical protein Y55F3BR.2 protein. Length = 1594 Score = 27.5 bits (58), Expect = 8.1 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = -1 Query: 407 AQRGHKFLCCWNLLGGYCHTRMTIF 333 +Q HK+ CC N+ G C + +++ Sbjct: 949 SQSNHKYYCCGNIQGSMCPSGRSLY 973 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,236,992 Number of Sequences: 27780 Number of extensions: 291995 Number of successful extensions: 697 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 662 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 695 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1342816466 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -