BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0536 (673 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0148 - 1051121-1051192,1051378-1051512,1052343-1052396,105... 29 3.4 03_05_0173 + 21502765-21504216 28 5.9 >02_01_0148 - 1051121-1051192,1051378-1051512,1052343-1052396, 1052501-1052581,1052667-1052826,1053346-1053453, 1053543-1053718,1053952-1054002,1054154-1054264, 1054493-1054547,1055667-1055789,1055922-1056007, 1056235-1056349,1056429-1056667 Length = 521 Score = 29.1 bits (62), Expect = 3.4 Identities = 15/44 (34%), Positives = 27/44 (61%), Gaps = 3/44 (6%) Frame = -3 Query: 401 DINEMTLQTSGHDIDS--HLV-RPKHQYVFSSTNNSEF*VLMTC 279 + +E L++S +D DS HL+ RP H+ F++T+ + +TC Sbjct: 166 EASEANLRSSNNDEDSSVHLISRPMHEITFATTDKPKVLSQLTC 209 >03_05_0173 + 21502765-21504216 Length = 483 Score = 28.3 bits (60), Expect = 5.9 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +1 Query: 112 PASPPRRCGTNNPSNYGMKHTENTGKEIMVSKIFVP 219 P SPP CG P N G T+ +++M + P Sbjct: 272 PLSPPPPCGMAKPPNSGDPLTDQNNQQLMANTHSAP 307 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,409,587 Number of Sequences: 37544 Number of extensions: 290764 Number of successful extensions: 703 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 687 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 703 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1703141568 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -