BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0536 (673 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 24 1.5 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 23 2.0 L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. 23 3.5 AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 22 6.1 AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 21 8.1 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 23.8 bits (49), Expect = 1.5 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +2 Query: 71 PQPGAEPYRFGDRFPHHHRADVERTIRQTME*NIQK 178 P PGA+ FG P + DV T + + I+K Sbjct: 479 PLPGADDDLFGPASPAYVHEDVSPTFEKPLVREIEK 514 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 23.4 bits (48), Expect = 2.0 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = +3 Query: 549 SDSQITDLFTKRHEYESHLL*TSSNSKCSFSRANNES 659 SDS++ DL TK ++ L +++ S CS + A ++ Sbjct: 492 SDSRLLDLCTKFLMHKDSLGLSTATSTCSLAVAKQQN 528 >L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. Length = 382 Score = 22.6 bits (46), Expect = 3.5 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +3 Query: 33 TPKRTKILPYIWNPSREPNPTAL 101 T R K+LPY W ++ T L Sbjct: 288 TTSRKKVLPYYWYKYQDRRDTDL 310 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 21.8 bits (44), Expect = 6.1 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +1 Query: 109 IPASPPRRCGTNNPS 153 +PA PPR G N P+ Sbjct: 13 LPAGPPRLLGWNVPA 27 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 21.4 bits (43), Expect = 8.1 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = +1 Query: 25 GTQHRNELKFCLTYGTPAG 81 GT + FC+T+G AG Sbjct: 237 GTNVMGMIVFCITFGLVAG 255 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,226 Number of Sequences: 438 Number of extensions: 3791 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20343105 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -