BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0536 (673 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g47930.1 68415.m05993 hydroxyproline-rich glycoprotein family... 27 8.6 At1g73960.1 68414.m08565 expressed protein similar to TATA bindi... 27 8.6 >At2g47930.1 68415.m05993 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 136 Score = 27.5 bits (58), Expect = 8.6 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +3 Query: 27 NPTPKRTKILPYIWNPSREPNPTALVIDSRITTAPM 134 +P+P + I+P I + PNP A+ D + +P+ Sbjct: 66 SPSPSESSIMPTIPSSLSPPNPDAVTPDPLLEVSPV 101 >At1g73960.1 68414.m08565 expressed protein similar to TATA binding protein associated factor (GI:2827282) [Homo sapiens]; similar to Transcription initiation factor TFIID 150 kDa subunit (TAFII-150) (TAFII150) (Swiss-Prot:Q24325) [Drosophila melanogaster] Length = 1390 Score = 27.5 bits (58), Expect = 8.6 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = +1 Query: 160 GMKHTENTGKEIMVSKIFVPLDNSKK 237 G K +ENTG +++ K+F+ +D K+ Sbjct: 14 GAKTSENTGAKVLHQKLFLSIDFKKR 39 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,105,806 Number of Sequences: 28952 Number of extensions: 254216 Number of successful extensions: 585 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 571 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 585 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1422784080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -