BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0532 (619 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY596807-1|AAT42127.1| 634|Homo sapiens sodium-dependent amino ... 33 1.1 AY591756-1|AAT66171.1| 634|Homo sapiens system B0 neutral amino... 33 1.1 AB209296-1|BAD92533.1| 383|Homo sapiens syntaxin 16 isoform a v... 31 3.3 BC068507-1|AAH68507.1| 778|Homo sapiens chromosome 11 open read... 31 4.3 AK027207-1|BAB15691.1| 724|Homo sapiens protein ( Homo sapiens ... 31 4.3 AY034072-1|AAK56405.1| 2713|Homo sapiens chromodomain helicase D... 29 9.9 AL121674-2|CAI21744.1| 2715|Homo sapiens chromodomain helicase D... 29 9.9 AL031669-3|CAI22255.1| 2715|Homo sapiens chromodomain helicase D... 29 9.9 AL031667-8|CAI42983.1| 524|Homo sapiens chromodomain helicase D... 29 9.9 AL031667-2|CAI42977.1| 2715|Homo sapiens chromodomain helicase D... 29 9.9 AF525085-1|AAN59903.1| 488|Homo sapiens RIGB protein. 29 9.9 >AY596807-1|AAT42127.1| 634|Homo sapiens sodium-dependent amino acid transporter protein. Length = 634 Score = 32.7 bits (71), Expect = 1.1 Identities = 16/52 (30%), Positives = 30/52 (57%) Frame = -2 Query: 177 LSVLKNFINIYVVILVSVLLGNR*ARHE*KCSNC*TLHVCNGFNQHKSDVTQ 22 +S++ F ++YV I+V ++G R + C + L + NGF+ + +VTQ Sbjct: 306 VSIINGFTSVYVAIVVYSVIGFRATQRYDDCFSTNILTLINGFDLPEGNVTQ 357 >AY591756-1|AAT66171.1| 634|Homo sapiens system B0 neutral amino acid transporter protein. Length = 634 Score = 32.7 bits (71), Expect = 1.1 Identities = 16/52 (30%), Positives = 30/52 (57%) Frame = -2 Query: 177 LSVLKNFINIYVVILVSVLLGNR*ARHE*KCSNC*TLHVCNGFNQHKSDVTQ 22 +S++ F ++YV I+V ++G R + C + L + NGF+ + +VTQ Sbjct: 306 VSIINGFTSVYVAIVVYSVIGFRATQRYDDCFSTNILTLINGFDLPEGNVTQ 357 >AB209296-1|BAD92533.1| 383|Homo sapiens syntaxin 16 isoform a variant protein. Length = 383 Score = 31.1 bits (67), Expect = 3.3 Identities = 24/62 (38%), Positives = 33/62 (53%) Frame = +2 Query: 227 PMGRNLKLISKTECRQRVRSVQINRRCQPERSLNTLSSTKLITGSR*RPNMIPKMNSKKS 406 P+GR+ +S ECR V +V NR+ + ERS TL+ + TG K N+KKS Sbjct: 323 PLGRSSSCLSPLECRVPVCNVFANRK-KSERSSYTLACSVPGTGG--------KKNNKKS 373 Query: 407 TR 412 R Sbjct: 374 KR 375 >BC068507-1|AAH68507.1| 778|Homo sapiens chromosome 11 open reading frame 63 protein. Length = 778 Score = 30.7 bits (66), Expect = 4.3 Identities = 18/80 (22%), Positives = 43/80 (53%), Gaps = 1/80 (1%) Frame = +2 Query: 209 TKAAALPMGRNLKLISKTECRQRVRSVQINRRCQPERSLNTLSSTKLITGSR*RPNMIPK 388 TK++ +P G+ +++ + +R ++I ++C+ + L + S+T+ +T S+ N P+ Sbjct: 338 TKSSNVPRGQPSDMVNDHQPSRRPAKLKIRKQCKHQNGLKS-STTEEVTASQGNQNNPPR 396 Query: 389 -MNSKKSTRDSSLVKTKLVI 445 ++ D+S +VI Sbjct: 397 QQQNQNKPLDTSTKPESIVI 416 >AK027207-1|BAB15691.1| 724|Homo sapiens protein ( Homo sapiens cDNA: FLJ23554 fis, clone LNG09359. ). Length = 724 Score = 30.7 bits (66), Expect = 4.3 Identities = 18/80 (22%), Positives = 43/80 (53%), Gaps = 1/80 (1%) Frame = +2 Query: 209 TKAAALPMGRNLKLISKTECRQRVRSVQINRRCQPERSLNTLSSTKLITGSR*RPNMIPK 388 TK++ +P G+ +++ + +R ++I ++C+ + L + S+T+ +T S+ N P+ Sbjct: 284 TKSSNVPRGQPSDMVNDHQPSRRPAKLKIRKQCKHQNGLKS-STTEEVTASQGNQNNPPR 342 Query: 389 -MNSKKSTRDSSLVKTKLVI 445 ++ D+S +VI Sbjct: 343 QQQNQNKPLDTSTKPESIVI 362 >AY034072-1|AAK56405.1| 2713|Homo sapiens chromodomain helicase DNA binding protein 5 protein. Length = 2713 Score = 29.5 bits (63), Expect = 9.9 Identities = 15/63 (23%), Positives = 32/63 (50%) Frame = +1 Query: 280 AKCTDKQKVSARKIVKHIKQHEADYWEQMKAKYDPKDEFKEIYEGFLAGQN*TCYKCLRW 459 AK + + + +KH+++ +D W++++ + K+ ++ E L G N + W Sbjct: 419 AKVKEFESLQVLPEIKHVERPASDSWQKLEKSREYKNS-NQLREYQLEGMN---WLLFNW 474 Query: 460 YNR 468 YNR Sbjct: 475 YNR 477 >AL121674-2|CAI21744.1| 2715|Homo sapiens chromodomain helicase DNA binding protein 6 protein. Length = 2715 Score = 29.5 bits (63), Expect = 9.9 Identities = 15/63 (23%), Positives = 32/63 (50%) Frame = +1 Query: 280 AKCTDKQKVSARKIVKHIKQHEADYWEQMKAKYDPKDEFKEIYEGFLAGQN*TCYKCLRW 459 AK + + + +KH+++ +D W++++ + K+ ++ E L G N + W Sbjct: 421 AKVKEFESLQVLPEIKHVERPASDSWQKLEKSREYKNS-NQLREYQLEGMN---WLLFNW 476 Query: 460 YNR 468 YNR Sbjct: 477 YNR 479 >AL031669-3|CAI22255.1| 2715|Homo sapiens chromodomain helicase DNA binding protein 6 protein. Length = 2715 Score = 29.5 bits (63), Expect = 9.9 Identities = 15/63 (23%), Positives = 32/63 (50%) Frame = +1 Query: 280 AKCTDKQKVSARKIVKHIKQHEADYWEQMKAKYDPKDEFKEIYEGFLAGQN*TCYKCLRW 459 AK + + + +KH+++ +D W++++ + K+ ++ E L G N + W Sbjct: 421 AKVKEFESLQVLPEIKHVERPASDSWQKLEKSREYKNS-NQLREYQLEGMN---WLLFNW 476 Query: 460 YNR 468 YNR Sbjct: 477 YNR 479 >AL031667-8|CAI42983.1| 524|Homo sapiens chromodomain helicase DNA binding protein 6 protein. Length = 524 Score = 29.5 bits (63), Expect = 9.9 Identities = 15/63 (23%), Positives = 32/63 (50%) Frame = +1 Query: 280 AKCTDKQKVSARKIVKHIKQHEADYWEQMKAKYDPKDEFKEIYEGFLAGQN*TCYKCLRW 459 AK + + + +KH+++ +D W++++ + K+ ++ E L G N + W Sbjct: 123 AKVKEFESLQVLPEIKHVERPASDSWQKLEKSREYKNS-NQLREYQLEGMN---WLLFNW 178 Query: 460 YNR 468 YNR Sbjct: 179 YNR 181 >AL031667-2|CAI42977.1| 2715|Homo sapiens chromodomain helicase DNA binding protein 6 protein. Length = 2715 Score = 29.5 bits (63), Expect = 9.9 Identities = 15/63 (23%), Positives = 32/63 (50%) Frame = +1 Query: 280 AKCTDKQKVSARKIVKHIKQHEADYWEQMKAKYDPKDEFKEIYEGFLAGQN*TCYKCLRW 459 AK + + + +KH+++ +D W++++ + K+ ++ E L G N + W Sbjct: 421 AKVKEFESLQVLPEIKHVERPASDSWQKLEKSREYKNS-NQLREYQLEGMN---WLLFNW 476 Query: 460 YNR 468 YNR Sbjct: 477 YNR 479 >AF525085-1|AAN59903.1| 488|Homo sapiens RIGB protein. Length = 488 Score = 29.5 bits (63), Expect = 9.9 Identities = 15/63 (23%), Positives = 32/63 (50%) Frame = +1 Query: 280 AKCTDKQKVSARKIVKHIKQHEADYWEQMKAKYDPKDEFKEIYEGFLAGQN*TCYKCLRW 459 AK + + + +KH+++ +D W++++ + K+ ++ E L G N + W Sbjct: 87 AKVKEFESLQVLPEIKHVERPASDSWQKLEKSREYKNS-NQLREYQLEGMN---WLLFNW 142 Query: 460 YNR 468 YNR Sbjct: 143 YNR 145 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 81,378,669 Number of Sequences: 237096 Number of extensions: 1645487 Number of successful extensions: 2913 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 2831 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2913 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6635341780 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -