BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0531 (662 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory recept... 22 5.2 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 6.8 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 6.8 AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 21 9.0 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 9.0 >AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory receptor candidate 58 protein. Length = 376 Score = 21.8 bits (44), Expect = 5.2 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +2 Query: 449 LYTKSVNFFTIKFEL 493 +Y K + FF I FE+ Sbjct: 65 IYCKEIRFFEISFEI 79 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 6.8 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 296 VGKLYKCIVSTTITTNK 246 V KL+KC++ T NK Sbjct: 1081 VNKLFKCMICTYKADNK 1097 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 6.8 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 296 VGKLYKCIVSTTITTNK 246 V KL+KC++ T NK Sbjct: 1081 VNKLFKCMICTYKADNK 1097 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/31 (25%), Positives = 17/31 (54%) Frame = +2 Query: 449 LYTKSVNFFTIKFELYS*TFYILYASTFHAK 541 ++ K V F + LY +Y++ +TF+ + Sbjct: 61 IHIKIVLMFFKEASLYCFNYYVIVVTTFYKR 91 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 498 ARPSTSYMPVPSMPRTI 548 A P+ +P PS PR+I Sbjct: 53 ASPTPGDVPTPSSPRSI 69 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,597 Number of Sequences: 336 Number of extensions: 3782 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17177325 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -