BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0530 (697 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435335-1|ABD92650.1| 135|Apis mellifera OBP18 protein. 27 0.23 DQ435338-1|ABD92653.1| 135|Apis mellifera OBP21 protein. 23 2.1 DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 22 4.8 AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor p... 21 8.5 AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropi... 21 8.5 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 8.5 >DQ435335-1|ABD92650.1| 135|Apis mellifera OBP18 protein. Length = 135 Score = 26.6 bits (56), Expect = 0.23 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +2 Query: 593 VGLRYFVPLSLNEQKIEKSKQDDSKLNRIETD 688 +GLR VP+ E I++ K+DD + I+ + Sbjct: 24 IGLRAVVPICRIETSIDQQKEDDFRDGNIDVE 55 >DQ435338-1|ABD92653.1| 135|Apis mellifera OBP21 protein. Length = 135 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/32 (28%), Positives = 19/32 (59%) Frame = +2 Query: 593 VGLRYFVPLSLNEQKIEKSKQDDSKLNRIETD 688 +GLR +P+ + I++ K+DD + I+ + Sbjct: 24 IGLRAVIPVCRIDSGIDEKKEDDFRNGIIDVE 55 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 22.2 bits (45), Expect = 4.8 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -1 Query: 454 RSSWNVVYDMRVSRLRFEGLGSPLSVGVW 368 RSS +V M + + F GL S L++G W Sbjct: 305 RSSQSVAEVMDRNGVLFFGLLSDLAIGCW 333 >AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor protein. Length = 139 Score = 21.4 bits (43), Expect = 8.5 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -1 Query: 550 IVLGGFCLYWLNCSSVWYV 494 I++GGF L WL +++ V Sbjct: 13 IIVGGFILCWLPFFTMYLV 31 >AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropin releasing hormone-binding protein protein. Length = 332 Score = 21.4 bits (43), Expect = 8.5 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +2 Query: 47 VCASDLLCSRKRPSEFDYRNFDVTCERNKGL 139 VC L + E ++ FD+ CE ++GL Sbjct: 91 VCGIYFLAEPDQKIEINFITFDIPCE-HRGL 120 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.4 bits (43), Expect = 8.5 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -1 Query: 550 IVLGGFCLYWLNCSSVWYV 494 I++GGF L WL +++ V Sbjct: 461 IIVGGFILCWLPFFTMYLV 479 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,873 Number of Sequences: 438 Number of extensions: 3992 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21317625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -