BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0529 (687 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. 25 3.0 AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. 24 5.2 AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydroge... 24 5.2 >AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. Length = 722 Score = 24.6 bits (51), Expect = 3.0 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -1 Query: 657 IRSDFAAVMIFKHSTTPGTDSCSKAEYSPSVCS 559 I ++ V+IF S+ + S AE SPS S Sbjct: 654 ISAEMRTVLIFAPSSNQSSSSTPNAEQSPSASS 686 >AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. Length = 1187 Score = 23.8 bits (49), Expect = 5.2 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 78 IFFELLCRDLNMLERVYTQVR 140 I F+ +CRD+ L R+Y R Sbjct: 218 IEFQKVCRDIEYLTRLYVSYR 238 >AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydrogenase protein. Length = 1325 Score = 23.8 bits (49), Expect = 5.2 Identities = 11/52 (21%), Positives = 19/52 (36%) Frame = +2 Query: 101 GSQHVGKGVHTSSVTTEKNVCYAPFGALQPRATKEGRIKCTLIPGDGVGPEL 256 G +G+G+HT + PF + T ++ T G +L Sbjct: 1025 GGTEMGQGLHTKMIQVAATALGIPFDRIHISETSTDKVPNTSATAASAGSDL 1076 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 742,261 Number of Sequences: 2352 Number of extensions: 16493 Number of successful extensions: 32 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -