BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0527 (609 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC622.21 |wtf12||wtf element Wtf12|Schizosaccharomyces pombe|c... 29 0.40 SPBC21B10.03c |||ataxin-2 homolog|Schizosaccharomyces pombe|chr ... 26 3.7 SPBC2A9.04c |||sir antagonist ortholog |Schizosaccharomyces pomb... 25 8.7 SPAC1834.08 |mak1|phk3|histidine kinase Mak1|Schizosaccharomyces... 25 8.7 SPCC320.03 |||transcription factor |Schizosaccharomyces pombe|ch... 25 8.7 >SPCC622.21 |wtf12||wtf element Wtf12|Schizosaccharomyces pombe|chr 3|||Manual Length = 197 Score = 29.5 bits (63), Expect = 0.40 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = +3 Query: 132 TGAPLSACRDMMPQHNATAQTSPPPYTITTDAQSVAPGDS 251 TG + + +P+HN+ +++ PPY+ + ++ P DS Sbjct: 20 TGHEIDLEKGPLPEHNSEGESTLPPYSDISKLANLVPEDS 59 >SPBC21B10.03c |||ataxin-2 homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 791 Score = 26.2 bits (55), Expect = 3.7 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 129 STGAPLSACRDMMPQHNATAQTSPPPYT 212 S AP++A R MMPQ + ++ S P T Sbjct: 451 SKPAPVNASRPMMPQQSNNSEASIPSTT 478 >SPBC2A9.04c |||sir antagonist ortholog |Schizosaccharomyces pombe|chr 2|||Manual Length = 741 Score = 25.0 bits (52), Expect = 8.7 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 Query: 216 TTDAQSVAPGDSVEVVIAGKLPEDTL 293 +T AQ A G S+ V AG+ P D + Sbjct: 572 STPAQQSAAGSSINVDTAGRQPSDEI 597 >SPAC1834.08 |mak1|phk3|histidine kinase Mak1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1639 Score = 25.0 bits (52), Expect = 8.7 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -2 Query: 551 SRLYSDPEDLQCLDDGGAEHD 489 S +Y+ P L+C DGG+ +D Sbjct: 224 SDIYNTPWQLRCYYDGGSHYD 244 >SPCC320.03 |||transcription factor |Schizosaccharomyces pombe|chr 3|||Manual Length = 867 Score = 25.0 bits (52), Expect = 8.7 Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Frame = -3 Query: 337 PRMSSPC--RACSKYPRKVSSGSLPAITTSTLSPGA 236 P SP +A YP+ + GS+ + T S L P A Sbjct: 226 PMKLSPANQQAMPPYPQMLGPGSISSYTNSNLGPSA 261 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,896,964 Number of Sequences: 5004 Number of extensions: 31067 Number of successful extensions: 122 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 121 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 122 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 268287866 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -