BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0527 (609 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein p... 26 0.83 DQ999006-1|ABJ99082.1| 282|Anopheles gambiae voltage-dependent ... 24 4.4 AY137768-1|AAN16031.1| 282|Anopheles gambiae porin protein. 24 4.4 AY082909-1|AAL89811.1| 282|Anopheles gambiae porin protein. 24 4.4 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 24 4.4 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 24 4.4 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 24 4.4 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 24 4.4 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 24 4.4 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 24 4.4 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 24 4.4 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 24 4.4 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 24 4.4 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 24 4.4 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 24 4.4 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 24 4.4 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 24 4.4 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 24 4.4 AY823259-1|AAX18444.1| 194|Anopheles gambiae pburs protein. 23 5.8 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 23 5.8 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 23 7.7 >AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein protein. Length = 492 Score = 26.2 bits (55), Expect = 0.83 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +3 Query: 174 HNATAQTSPPPYTITTDAQSVAPGDSV-EVVIAGKLPED 287 H A+ + + PP T+A VAPG+++ V I KL D Sbjct: 241 HPASTREALPPRRPKTEAVLVAPGENITHVEILRKLKAD 279 >DQ999006-1|ABJ99082.1| 282|Anopheles gambiae voltage-dependent anion channel protein. Length = 282 Score = 23.8 bits (49), Expect = 4.4 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +3 Query: 417 KHDNKEDKRQVRVRWSPPQGLTGEVVFRATIVKTLKVFWVGV 542 K+ KE +W+ LT EV +VK LKV + G+ Sbjct: 60 KYKVKEYGLNFSEKWNTDNTLTSEVSVENQLVKGLKVSFDGM 101 >AY137768-1|AAN16031.1| 282|Anopheles gambiae porin protein. Length = 282 Score = 23.8 bits (49), Expect = 4.4 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +3 Query: 417 KHDNKEDKRQVRVRWSPPQGLTGEVVFRATIVKTLKVFWVGV 542 K+ KE +W+ LT EV +VK LKV + G+ Sbjct: 60 KYKVKEYGLNFSEKWNTDNTLTSEVSVENQLVKGLKVSFDGM 101 >AY082909-1|AAL89811.1| 282|Anopheles gambiae porin protein. Length = 282 Score = 23.8 bits (49), Expect = 4.4 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +3 Query: 417 KHDNKEDKRQVRVRWSPPQGLTGEVVFRATIVKTLKVFWVGV 542 K+ KE +W+ LT EV +VK LKV + G+ Sbjct: 60 KYKVKEYGLNFSEKWNTDNTLTSEVSVENQLVKGLKVSFDGM 101 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 23.8 bits (49), Expect = 4.4 Identities = 12/42 (28%), Positives = 25/42 (59%), Gaps = 2/42 (4%) Frame = -3 Query: 334 RMSSPCRACSKYPRKVSSGSLPAITTSTLSPG--ATLCASVV 215 R+ P R C +++SS ++PA ++ + + G +T+ +S V Sbjct: 1849 RLYQPVRLCGPCYQRISSMTVPATSSVSTTGGSSSTMVSSAV 1890 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 23.8 bits (49), Expect = 4.4 Identities = 12/42 (28%), Positives = 25/42 (59%), Gaps = 2/42 (4%) Frame = -3 Query: 334 RMSSPCRACSKYPRKVSSGSLPAITTSTLSPG--ATLCASVV 215 R+ P R C +++SS ++PA ++ + + G +T+ +S V Sbjct: 1850 RLYQPVRLCGPCYQRISSMTVPATSSVSTTGGSSSTMVSSAV 1891 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 23.8 bits (49), Expect = 4.4 Identities = 8/25 (32%), Positives = 16/25 (64%) Frame = +3 Query: 309 QARQGDDILGTFSLEDGDVFSQLIN 383 + R GD++ G +SL D D ++++ Sbjct: 111 ETRHGDEVHGQYSLLDSDGHQRIVD 135 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 23.8 bits (49), Expect = 4.4 Identities = 8/25 (32%), Positives = 16/25 (64%) Frame = +3 Query: 309 QARQGDDILGTFSLEDGDVFSQLIN 383 + R GD++ G +SL D D ++++ Sbjct: 103 ETRHGDEVHGQYSLLDSDGHQRIVD 127 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.8 bits (49), Expect = 4.4 Identities = 8/25 (32%), Positives = 16/25 (64%) Frame = +3 Query: 309 QARQGDDILGTFSLEDGDVFSQLIN 383 + R GD++ G +SL D D ++++ Sbjct: 103 ETRHGDEVHGQYSLLDSDGHQRIVD 127 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 23.8 bits (49), Expect = 4.4 Identities = 8/25 (32%), Positives = 16/25 (64%) Frame = +3 Query: 309 QARQGDDILGTFSLEDGDVFSQLIN 383 + R GD++ G +SL D D ++++ Sbjct: 103 ETRHGDEVHGQYSLLDSDGHQRIVD 127 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.8 bits (49), Expect = 4.4 Identities = 8/25 (32%), Positives = 16/25 (64%) Frame = +3 Query: 309 QARQGDDILGTFSLEDGDVFSQLIN 383 + R GD++ G +SL D D ++++ Sbjct: 103 ETRHGDEVHGQYSLLDSDGHQRIVD 127 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.8 bits (49), Expect = 4.4 Identities = 8/25 (32%), Positives = 16/25 (64%) Frame = +3 Query: 309 QARQGDDILGTFSLEDGDVFSQLIN 383 + R GD++ G +SL D D ++++ Sbjct: 111 ETRHGDEVHGQYSLLDSDGHQRIVD 135 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 23.8 bits (49), Expect = 4.4 Identities = 8/25 (32%), Positives = 16/25 (64%) Frame = +3 Query: 309 QARQGDDILGTFSLEDGDVFSQLIN 383 + R GD++ G +SL D D ++++ Sbjct: 135 ETRHGDEVHGQYSLLDSDGHQRIVD 159 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 23.8 bits (49), Expect = 4.4 Identities = 8/25 (32%), Positives = 16/25 (64%) Frame = +3 Query: 309 QARQGDDILGTFSLEDGDVFSQLIN 383 + R GD++ G +SL D D ++++ Sbjct: 103 ETRHGDEVHGQYSLLDSDGHQRIVD 127 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 23.8 bits (49), Expect = 4.4 Identities = 8/25 (32%), Positives = 16/25 (64%) Frame = +3 Query: 309 QARQGDDILGTFSLEDGDVFSQLIN 383 + R GD++ G +SL D D ++++ Sbjct: 111 ETRHGDEVHGQYSLLDSDGHQRIVD 135 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 23.8 bits (49), Expect = 4.4 Identities = 8/25 (32%), Positives = 16/25 (64%) Frame = +3 Query: 309 QARQGDDILGTFSLEDGDVFSQLIN 383 + R GD++ G +SL D D ++++ Sbjct: 103 ETRHGDEVHGQYSLLDSDGHQRIVD 127 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 23.8 bits (49), Expect = 4.4 Identities = 8/25 (32%), Positives = 16/25 (64%) Frame = +3 Query: 309 QARQGDDILGTFSLEDGDVFSQLIN 383 + R GD++ G +SL D D ++++ Sbjct: 111 ETRHGDEVHGQYSLLDSDGHQRIVD 135 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 23.8 bits (49), Expect = 4.4 Identities = 8/25 (32%), Positives = 16/25 (64%) Frame = +3 Query: 309 QARQGDDILGTFSLEDGDVFSQLIN 383 + R GD++ G +SL D D ++++ Sbjct: 103 ETRHGDEVHGQYSLLDSDGHQRIVD 127 >AY823259-1|AAX18444.1| 194|Anopheles gambiae pburs protein. Length = 194 Score = 23.4 bits (48), Expect = 5.8 Identities = 10/52 (19%), Positives = 21/52 (40%) Frame = -3 Query: 232 LCASVVMV*GGGEVCAVALCCGIMSRQALSGAPVERASDTRDVITNITTAAH 77 +C SV C++ LCC ++ L+ A + + + + + H Sbjct: 42 MCNSVRTALAASNCCSIVLCCVLLLTLTLTVAVTAQHNQADETCETLPSEIH 93 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.4 bits (48), Expect = 5.8 Identities = 8/25 (32%), Positives = 16/25 (64%) Frame = +3 Query: 309 QARQGDDILGTFSLEDGDVFSQLIN 383 + R GD++ G +SL D D ++++ Sbjct: 111 ETRHGDEVHGQYSLLDSDGHHRIVD 135 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -2 Query: 512 DDGGAEHDLPGETLGRRP 459 D+G E D PGET P Sbjct: 792 DEGYEEQDTPGETFDELP 809 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 526,940 Number of Sequences: 2352 Number of extensions: 9730 Number of successful extensions: 38 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 59291487 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -