BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0527 (609 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 3.1 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 23 3.1 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 21 7.1 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 22.6 bits (46), Expect = 3.1 Identities = 11/35 (31%), Positives = 15/35 (42%) Frame = +3 Query: 102 MTSRVSEARSTGAPLSACRDMMPQHNATAQTSPPP 206 +T +E +G P S D + QH PPP Sbjct: 967 VTIITAEEAPSGPPTSIRVDDLDQHTLKVTWKPPP 1001 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 22.6 bits (46), Expect = 3.1 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = -2 Query: 569 GYNFNWSRLYSDPEDLQCLDDGGAEHDLPGETLGRRPAH 453 G + +W + Y+ E CL GG+ + G+ LG H Sbjct: 119 GGDLDW-KYYTTNESHACLSTGGSCYWPRGKNLGGTTLH 156 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 7.1 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = -2 Query: 602 NYSGSYRRRCSGYNFNWSRL 543 NY+ +Y + YN N+ +L Sbjct: 93 NYNNNYNNYNNNYNTNYKKL 112 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 137,101 Number of Sequences: 438 Number of extensions: 2409 Number of successful extensions: 21 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17971191 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -