BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0524 (652 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0726 + 5440341-5440661,5441574-5441620,5442917-5442977,544... 31 0.60 >02_01_0726 + 5440341-5440661,5441574-5441620,5442917-5442977, 5442978-5443035,5443303-5443463,5443692-5443808, 5443888-5443989,5444834-5444908,5444996-5445084, 5445171-5445220,5445562-5445641,5445744-5445953, 5446103-5446170,5446363-5446423,5446719-5447081 Length = 620 Score = 31.5 bits (68), Expect = 0.60 Identities = 18/46 (39%), Positives = 28/46 (60%), Gaps = 6/46 (13%) Frame = +1 Query: 457 YTILSLCLNINDGYP--FVMSTNSSYH----LTSAEIVSVSIVGTK 576 + I+ L LNIN GYP F ++N+ +H L+ ++ + IVGTK Sbjct: 350 FVIVFLLLNINGGYPLNFSFASNAGWHTYFWLSFLPLILLLIVGTK 395 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,877,393 Number of Sequences: 37544 Number of extensions: 314888 Number of successful extensions: 568 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 558 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 568 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1620349964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -