BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0524 (652 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41208| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_18062| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_12407| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 >SB_41208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 30.3 bits (65), Expect = 1.4 Identities = 15/52 (28%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = +1 Query: 457 YTILSLCLNI-NDGYPFVMSTNSSYHLTSAEIVSVSIVGTKETICDQTFIST 609 Y L C + N YP +ST+ HL+ ++ +++ K+++ D T+I T Sbjct: 9 YQPLKSCTPLTNSCYPIYLSTHPQTHLSKRQLNVLTLTPLKKSLVDLTWIRT 60 >SB_18062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 29.1 bits (62), Expect = 3.3 Identities = 15/52 (28%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = +1 Query: 457 YTILSLCLNI-NDGYPFVMSTNSSYHLTSAEIVSVSIVGTKETICDQTFIST 609 Y L C + N YP +ST+ HL+ ++ +++ K+++ D T+I T Sbjct: 9 YQPLKPCTPLTNSCYPIHLSTHPQNHLSKRQLNVLTLTPLKKSLVDLTWIRT 60 >SB_12407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 28.7 bits (61), Expect = 4.3 Identities = 12/41 (29%), Positives = 24/41 (58%) Frame = +1 Query: 487 NDGYPFVMSTNSSYHLTSAEIVSVSIVGTKETICDQTFIST 609 N YP +ST+ HL+ ++ +++ K+++ D T+I T Sbjct: 20 NSCYPIHLSTHPQTHLSKRQLNVLTLTPLKKSLVDLTWIRT 60 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,817,937 Number of Sequences: 59808 Number of extensions: 371528 Number of successful extensions: 662 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 627 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 662 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1657237625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -