BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0521 (688 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC110506-1|AAI10507.1| 695|Homo sapiens LMBR1 domain containing... 35 0.31 AL137370-1|CAB70714.1| 205|Homo sapiens hypothetical protein pr... 32 2.2 BC030146-1|AAH30146.1| 717|Homo sapiens RNA binding motif prote... 30 6.7 AK025571-1|BAB15173.1| 727|Homo sapiens osaminidase mRNA. prot... 30 6.7 >BC110506-1|AAI10507.1| 695|Homo sapiens LMBR1 domain containing 2 protein. Length = 695 Score = 34.7 bits (76), Expect = 0.31 Identities = 31/110 (28%), Positives = 53/110 (48%), Gaps = 4/110 (3%) Frame = -2 Query: 390 NMFAPSILFYHIPFLRSLPSYPYRLSHNPSIS-S*VY---LFL*ILPHS*LTLS*QPHFH 223 ++F SI Y F + +Y Y SH+ + + S ++ LF + P L H Sbjct: 440 SIFFLSICVYSTVFRIRVFNYYYLASHHQTDAYSLLFSGMLFCRLTPPLCLNFLGLTHMD 499 Query: 222 FVSSHVHTIPNAHSSVSMSQVPLLDFL*HTHSVFYPFSLLHTSIATFASL 73 SH +T P A++S+ M + +L F+ ++YP ++ IAT+ SL Sbjct: 500 SSISHKNTQPTAYTSI-MGSMKVLSFIADGFYIYYPMLVVILCIATYFSL 548 >AL137370-1|CAB70714.1| 205|Homo sapiens hypothetical protein protein. Length = 205 Score = 31.9 bits (69), Expect = 2.2 Identities = 17/53 (32%), Positives = 29/53 (54%) Frame = -2 Query: 231 HFHFVSSHVHTIPNAHSSVSMSQVPLLDFL*HTHSVFYPFSLLHTSIATFASL 73 H SH +T P A++S+ M + +L F+ ++YP ++ IAT+ SL Sbjct: 7 HMDSSISHKNTQPTAYTSI-MGSMKVLSFIADGFYIYYPMLVVILCIATYFSL 58 >BC030146-1|AAH30146.1| 717|Homo sapiens RNA binding motif protein 35B protein. Length = 717 Score = 30.3 bits (65), Expect = 6.7 Identities = 14/41 (34%), Positives = 25/41 (60%), Gaps = 3/41 (7%) Frame = -3 Query: 470 FAARGVVPTPYVIIIILPFPQSPGVGATCLL---LPYSSII 357 +A+ ++PT ++ +PFP +PG G C+ LPY++ I Sbjct: 438 YASGPLLPTLTAPLLPIPFPLAPGTGRDCVRLRGLPYTATI 478 >AK025571-1|BAB15173.1| 727|Homo sapiens osaminidase mRNA. protein. Length = 727 Score = 30.3 bits (65), Expect = 6.7 Identities = 14/41 (34%), Positives = 25/41 (60%), Gaps = 3/41 (7%) Frame = -3 Query: 470 FAARGVVPTPYVIIIILPFPQSPGVGATCLL---LPYSSII 357 +A+ ++PT ++ +PFP +PG G C+ LPY++ I Sbjct: 448 YASGPLLPTLTAPLLPIPFPLAPGTGRDCVRLRGLPYTATI 488 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 107,708,157 Number of Sequences: 237096 Number of extensions: 2396740 Number of successful extensions: 5240 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5045 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5236 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7839245960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -