BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0520 (677 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1223 + 24985730-24985916,24986008-24986039,24986790-249868... 40 0.002 >07_03_1223 + 24985730-24985916,24986008-24986039,24986790-24986879, 24987441-24987535,24987635-24987839,24988011-24988080, 24988564-24988642,24988859-24988926,24989114-24989202, 24989284-24989354,24989493-24989578,24989674-24989750 Length = 382 Score = 39.9 bits (89), Expect = 0.002 Identities = 31/110 (28%), Positives = 46/110 (41%), Gaps = 8/110 (7%) Frame = +1 Query: 316 PVAQPAEVLRAWQKDDQYEKQLADSISKLLPLQHGSKAIP--------ISSLLYKSFTTL 471 P A E++RA +KDD Y + ++ G++ + LY TT Sbjct: 29 PEAAQPEIMRAAEKDDGYAAHVTEACRDAFRHLFGTRVAVAYQNEIKLLGQSLYYLLTTG 88 Query: 472 KDLQTLGEEYSGIVQVDDSYHKLPSYYARLASVLLSTFGENLTRRFVNHV 621 QTLGEEY I QV S+ P+ R+ +L T L R + + Sbjct: 89 SGQQTLGEEYCDISQVATSHGLPPTPARRILFILYQTTVPYLAERISSRI 138 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,928,036 Number of Sequences: 37544 Number of extensions: 265644 Number of successful extensions: 526 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 518 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 526 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1726796312 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -