BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0520 (677 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY069290-1|AAL39435.1| 299|Drosophila melanogaster GM14467p pro... 76 5e-14 AE014296-286|AAF47512.1| 299|Drosophila melanogaster CG7864-PA ... 76 5e-14 >AY069290-1|AAL39435.1| 299|Drosophila melanogaster GM14467p protein. Length = 299 Score = 75.8 bits (178), Expect = 5e-14 Identities = 39/120 (32%), Positives = 71/120 (59%), Gaps = 7/120 (5%) Frame = +1 Query: 322 AQPAEVLRAWQKDDQYEKQLADSISKLLPL-------QHGSKAIPISSLLYKSFTTLKDL 480 A+ E++R+ QKD +Y +LA+ +S +L L ++ ++ L Y F + +L Sbjct: 8 ARQPEIVRSVQKDARYTNELAEDLSDVLRLTGPRNWIKYNQMCRLLAELSYHGFASANNL 67 Query: 481 QTLGEEYSGIVQVDDSYHKLPSYYARLASVLLSTFGENLTRRFVNHVGKKIETNRSLRSE 660 QTLGEEY+GI+QVD +Y ++PS +L +++L G++L +R + + + N +R+E Sbjct: 68 QTLGEEYTGIIQVDGNYKQIPSRLLQLIAIVLEFGGDSLFQRLMQKLDTYVANNDEIRTE 127 >AE014296-286|AAF47512.1| 299|Drosophila melanogaster CG7864-PA protein. Length = 299 Score = 75.8 bits (178), Expect = 5e-14 Identities = 39/120 (32%), Positives = 71/120 (59%), Gaps = 7/120 (5%) Frame = +1 Query: 322 AQPAEVLRAWQKDDQYEKQLADSISKLLPL-------QHGSKAIPISSLLYKSFTTLKDL 480 A+ E++R+ QKD +Y +LA+ +S +L L ++ ++ L Y F + +L Sbjct: 8 ARQPEIVRSVQKDARYTNELAEDLSDVLRLTGPRNWIKYNQMCRLLAELSYHGFASANNL 67 Query: 481 QTLGEEYSGIVQVDDSYHKLPSYYARLASVLLSTFGENLTRRFVNHVGKKIETNRSLRSE 660 QTLGEEY+GI+QVD +Y ++PS +L +++L G++L +R + + + N +R+E Sbjct: 68 QTLGEEYTGIIQVDGNYKQIPSRLLQLIAIVLEFGGDSLFQRLMQKLDTYVANNDEIRTE 127 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,113,825 Number of Sequences: 53049 Number of extensions: 486612 Number of successful extensions: 898 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 879 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 898 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2951284050 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -