BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0519 (683 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY118576-1|AAM49945.1| 509|Drosophila melanogaster LD43196p pro... 29 5.9 AE014296-3360|AAF51595.2| 509|Drosophila melanogaster CG5262-PA... 29 5.9 >AY118576-1|AAM49945.1| 509|Drosophila melanogaster LD43196p protein. Length = 509 Score = 29.1 bits (62), Expect = 5.9 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = -2 Query: 196 LFICIDIDIVMLSIIALTITEPLISITLTVCIRSL 92 L ICID + + I L+ + P+++ITL ++SL Sbjct: 366 LLICIDYFLALFPIFTLSTSFPIVAITLKNNLQSL 400 >AE014296-3360|AAF51595.2| 509|Drosophila melanogaster CG5262-PA protein. Length = 509 Score = 29.1 bits (62), Expect = 5.9 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = -2 Query: 196 LFICIDIDIVMLSIIALTITEPLISITLTVCIRSL 92 L ICID + + I L+ + P+++ITL ++SL Sbjct: 366 LLICIDYFLALFPIFTLSTSFPIVAITLKNNLQSL 400 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,664,246 Number of Sequences: 53049 Number of extensions: 461624 Number of successful extensions: 986 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 961 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 984 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2992560750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -