Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NRPG0519
         (683 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g32870.1 68415.m04030 meprin and TRAF homology domain-contain...    32   0.41 

>At2g32870.1 68415.m04030 meprin and TRAF homology domain-containing
           protein / MATH domain-containing protein similar to
           ubiquitin-specific protease 12 [Arabidopsis thaliana]
           GI:11993471; contains Pfam profile PF00917: MATH domain
          Length = 416

 Score = 31.9 bits (69), Expect = 0.41
 Identities = 12/36 (33%), Positives = 23/36 (63%)
 Frame = -3

Query: 651 DPRERKTWRTVYLYHQYRTLYFYFLQNCLIIDGNLF 544
           D R +K+ RT+ ++++   LYFYF +    I G+++
Sbjct: 19  DDRHKKSDRTLIVFNRKTPLYFYFFEQVRYITGSIY 54


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,635,039
Number of Sequences: 28952
Number of extensions: 227408
Number of successful extensions: 457
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 435
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 457
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1447936096
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)