BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0516 (647 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47633| Best HMM Match : Ank (HMM E-Value=1.7e-28) 33 0.20 SB_12152| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 >SB_47633| Best HMM Match : Ank (HMM E-Value=1.7e-28) Length = 353 Score = 33.1 bits (72), Expect = 0.20 Identities = 18/41 (43%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = +1 Query: 457 HNILRSTNRHYFQMNYLNRTCQKMVYKD-LYTYILYALEAI 576 H I RS +HYF +NYL+RT + KD T+ AL A+ Sbjct: 289 HYIDRSRRKHYFYINYLDRTTPESKDKDAASTHAQTALSAV 329 >SB_12152| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 27.5 bits (58), Expect = 9.9 Identities = 9/33 (27%), Positives = 19/33 (57%) Frame = -2 Query: 607 LTYPIEHFKFQLLLMHIICMYINLCRPFFDKFY 509 L + K ++ +H++C+Y N+ FFD ++ Sbjct: 51 LPLAVSDTKAAMIFLHVLCVYDNVESSFFDLYH 83 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,527,912 Number of Sequences: 59808 Number of extensions: 292535 Number of successful extensions: 618 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 503 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 601 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1645141000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -