BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0514 (506 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP23A10.16 |sdh4|tim18|TIM22 inner membrane protein import com... 39 4e-04 SPBP22H7.08 |rps1002|rps10-2, rps10B|40S ribosomal protein S10|S... 27 1.6 SPBC3B9.05 |||helper of TIM |Schizosaccharomyces pombe|chr 2|||M... 26 2.8 SPAC31G5.17c |rps1001|rps10-1|40S ribosomal protein S10|Schizosa... 25 4.9 SPBP8B7.27 |mug30||ubiquitin-protein ligase E3|Schizosaccharomyc... 25 6.5 >SPBP23A10.16 |sdh4|tim18|TIM22 inner membrane protein import complex anchor subunit Tim18|Schizosaccharomyces pombe|chr 2|||Manual Length = 186 Score = 39.1 bits (87), Expect = 4e-04 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 2/51 (3%) Frame = +1 Query: 352 WVIERVVSAALVP--LIPLALMMPNKLFDSLLAILITAHSFWGLEAIAVDY 498 W ER+++ A+VP +IPL + L D+ LA + H+ G E+ +DY Sbjct: 88 WDFERIIAIAMVPQVMIPLFTGTSHPLMDAALACTLITHAHLGFESCVIDY 138 >SPBP22H7.08 |rps1002|rps10-2, rps10B|40S ribosomal protein S10|Schizosaccharomyces pombe|chr 2|||Manual Length = 147 Score = 27.1 bits (57), Expect = 1.6 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = +3 Query: 99 YHTINNHGVLHVSSYIRMPKSNVHSTSYEASDPAS 203 Y+T+ N GV ++ Y+ +P V +T PA+ Sbjct: 65 YYTLTNEGVEYLREYLHLPAEVVPATHKRQVRPAA 99 >SPBC3B9.05 |||helper of TIM |Schizosaccharomyces pombe|chr 2|||Manual Length = 116 Score = 26.2 bits (55), Expect = 2.8 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +1 Query: 274 ILNAIRSFRTSCVRRSAEKVEDHSRL 351 +LNA S RT+C RR + +E H+ + Sbjct: 5 VLNAQVSIRTACCRRWIDCIECHNEI 30 >SPAC31G5.17c |rps1001|rps10-1|40S ribosomal protein S10|Schizosaccharomyces pombe|chr 1|||Manual Length = 144 Score = 25.4 bits (53), Expect = 4.9 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = +3 Query: 99 YHTINNHGVLHVSSYIRMPKSNVHST 176 Y+T+ N GV ++ Y+ +P V +T Sbjct: 65 YYTLTNEGVEYLREYLHLPAEVVPAT 90 >SPBP8B7.27 |mug30||ubiquitin-protein ligase E3|Schizosaccharomyces pombe|chr 2|||Manual Length = 807 Score = 25.0 bits (52), Expect = 6.5 Identities = 12/41 (29%), Positives = 19/41 (46%) Frame = +3 Query: 78 YKKVLVIYHTINNHGVLHVSSYIRMPKSNVHSTSYEASDPA 200 YK + +YH I N +L + +R +S + DPA Sbjct: 200 YKLIYQLYHDITNLDILITNELLRAIESLLRRPMLYCHDPA 240 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,098,541 Number of Sequences: 5004 Number of extensions: 42639 Number of successful extensions: 95 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 93 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 94 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 202220600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -