Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NRPG0514
         (506 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p...    24   2.6  
AY578799-1|AAT07304.1|  679|Anopheles gambiae brinker protein.         23   7.9  

>AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein
            protein.
          Length = 1077

 Score = 24.2 bits (50), Expect = 2.6
 Identities = 12/33 (36%), Positives = 19/33 (57%)
 Frame = -1

Query: 470  QKL*AVISIARRESNSLFGIMRANGINGTSAAE 372
            Q++  VIS     S  LFG++R   +NG +A +
Sbjct: 1013 QRISVVISGCPSSSTLLFGLLRLPVLNGINAGK 1045


>AY578799-1|AAT07304.1|  679|Anopheles gambiae brinker protein.
          Length = 679

 Score = 22.6 bits (46), Expect = 7.9
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -2

Query: 352 RAWSGPRPSPLTG 314
           R WS P+ SP++G
Sbjct: 553 RGWSSPQASPVSG 565


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 534,019
Number of Sequences: 2352
Number of extensions: 10628
Number of successful extensions: 51
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 50
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 51
length of database: 563,979
effective HSP length: 60
effective length of database: 422,859
effective search space used: 45668772
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)