BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0513 (469 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1393.07c |mug4||sequence orphan|Schizosaccharomyces pombe|ch... 28 0.62 SPBC16G5.01 |rpn12|mts3, SPBC342.07|19S proteasome regulatory su... 26 3.3 SPBC4F6.05c |||lectin |Schizosaccharomyces pombe|chr 2|||Manual 26 3.3 SPBC30D10.11 |gpi1||pig-Q|Schizosaccharomyces pombe|chr 2|||Manual 25 4.4 SPAC6G9.05 |pcd1||coenzyme A diphosphatase |Schizosaccharomyces ... 25 5.8 SPBC19F5.03 |||inositol polyphosphate phosphatase |Schizosacchar... 25 5.8 SPBC18E5.03c |sim4||kinetochore protein Sim4 |Schizosaccharomyce... 25 7.6 SPBC1198.07c |||mannan endo-1,6-alpha-mannosidase |Schizosacchar... 25 7.6 >SPCC1393.07c |mug4||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 845 Score = 28.3 bits (60), Expect = 0.62 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 165 ILQHRRPRLPLMQLEAPCSFNFCSLRA 85 I Q LP + L +PCSF CSLRA Sbjct: 48 IAQKSNISLPFLTL-SPCSFTICSLRA 73 >SPBC16G5.01 |rpn12|mts3, SPBC342.07|19S proteasome regulatory subunit Rpn12|Schizosaccharomyces pombe|chr 2|||Manual Length = 270 Score = 25.8 bits (54), Expect = 3.3 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +2 Query: 5 RNSARGCVEESYSKLP*S-T**LLYLRIARREQKLKE 112 RN C E+ YS++P S LLYL + +KL E Sbjct: 172 RNEIATCAEKVYSEIPLSNATSLLYLENTKETEKLAE 208 >SPBC4F6.05c |||lectin |Schizosaccharomyces pombe|chr 2|||Manual Length = 384 Score = 25.8 bits (54), Expect = 3.3 Identities = 15/37 (40%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +2 Query: 167 WHW-GSVDSISGSRARFQLSGNSGRKHSRCCTSILRK 274 W W GSVD SG N R S TS+LR+ Sbjct: 39 WKWYGSVDEDSGYVYLTSKDSNEARSGSLWSTSVLRQ 75 >SPBC30D10.11 |gpi1||pig-Q|Schizosaccharomyces pombe|chr 2|||Manual Length = 653 Score = 25.4 bits (53), Expect = 4.4 Identities = 12/46 (26%), Positives = 26/46 (56%) Frame = -2 Query: 252 QRLCFLPLFPLS*NRAREPLMESTDPQCHILQHRRPRLPLMQLEAP 115 +++ FL L PLS ++ + ++P+ +QH++ L ++L P Sbjct: 135 RKMQFLSLEPLSLLLLKDSFINKSNPEYESMQHQQILLKKLKLHFP 180 >SPAC6G9.05 |pcd1||coenzyme A diphosphatase |Schizosaccharomyces pombe|chr 1|||Manual Length = 285 Score = 25.0 bits (52), Expect = 5.8 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = -2 Query: 192 MESTDPQCHILQHRRPRLPLMQLEAPCSF 106 M+S Q ++L RP LPL P F Sbjct: 88 MDSLSHQIYLLHKNRPTLPLKPTNQPTRF 116 >SPBC19F5.03 |||inositol polyphosphate phosphatase |Schizosaccharomyces pombe|chr 2|||Manual Length = 598 Score = 25.0 bits (52), Expect = 5.8 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +2 Query: 350 TSPVLDIAPGSDLFCFIWN*NA 415 T P+ + P ++FC IW+ NA Sbjct: 411 THPLRSVIPLDNIFCNIWSDNA 432 >SPBC18E5.03c |sim4||kinetochore protein Sim4 |Schizosaccharomyces pombe|chr 2|||Manual Length = 277 Score = 24.6 bits (51), Expect = 7.6 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -2 Query: 450 LHRIDKFIKNLNAF*FQIKQKRSDPGAMSRTG 355 LH+I KF +L + + +++ AMSR G Sbjct: 119 LHQIKKFSSDLQSLKSSMGERQKQQAAMSRRG 150 >SPBC1198.07c |||mannan endo-1,6-alpha-mannosidase |Schizosaccharomyces pombe|chr 2|||Manual Length = 507 Score = 24.6 bits (51), Expect = 7.6 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = +2 Query: 98 QKLKEHGASSCISGKRGRRCCNIWHWGS 181 Q E A +C G G C +W+W + Sbjct: 394 QSSAEAAALACSGGSDGVTCGYMWYWNN 421 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,768,163 Number of Sequences: 5004 Number of extensions: 31736 Number of successful extensions: 65 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 65 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 65 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 178394480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -