BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0512 (637 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49565| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_20247| Best HMM Match : Keratin_B2 (HMM E-Value=0.1) 28 7.3 SB_43842| Best HMM Match : RNB (HMM E-Value=0) 28 7.3 SB_38582| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_32581| Best HMM Match : DUF1017 (HMM E-Value=8.4) 27 9.7 SB_55804| Best HMM Match : Acyl_transf_1 (HMM E-Value=1.2e-07) 27 9.7 SB_42738| Best HMM Match : 7tm_1 (HMM E-Value=0.89) 27 9.7 SB_22845| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 >SB_49565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1571 Score = 29.5 bits (63), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -2 Query: 321 PRTQVRKIVSLMHMTGLLRSETRTPVPPIAS 229 PR V+KI+ H GL+ + T T P +AS Sbjct: 820 PRFLVKKIIVFTHKKGLIMNPTGTTTPSLAS 850 >SB_20247| Best HMM Match : Keratin_B2 (HMM E-Value=0.1) Length = 356 Score = 27.9 bits (59), Expect = 7.3 Identities = 24/79 (30%), Positives = 32/79 (40%), Gaps = 7/79 (8%) Frame = -1 Query: 439 RPSSSTVPNVTGRPSSKRGIVTNIRDFLPDLCCT------STSIGTEDPGT*NRF-SNAY 281 RP+S + T RP+S+ T R F P T STS T P + + F + A Sbjct: 70 RPNSQSTFTTTARPNSQSTFTTTARPFQPTFTTTARPKSQSTSTTTARPNSLSTFTTTAR 129 Query: 280 DRASSFGNTNSSSAHCLTT 224 S+F T TT Sbjct: 130 PLQSTFTTTARPLQSTFTT 148 >SB_43842| Best HMM Match : RNB (HMM E-Value=0) Length = 1238 Score = 27.9 bits (59), Expect = 7.3 Identities = 14/45 (31%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = +3 Query: 192 WPGLGA-KNNLRVVRQWAELEFVFPNEEARSYALEKRFYVPGSSV 323 W LG+ N+ R+ R+W L F ++ R + FY P +V Sbjct: 1159 WTNLGSTSNSWRLTRRWVTLMVDFDSDALRFWGKGYGFYEPSLAV 1203 >SB_38582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1438 Score = 27.5 bits (58), Expect = 9.7 Identities = 10/36 (27%), Positives = 20/36 (55%) Frame = -2 Query: 348 YVAHRHQSAPRTQVRKIVSLMHMTGLLRSETRTPVP 241 Y AHR +SAP ++ +S+ ++ ++ + T P Sbjct: 209 YHAHRRRSAPSASIKSSISVKPLSSTVKPNSPTEAP 244 >SB_32581| Best HMM Match : DUF1017 (HMM E-Value=8.4) Length = 308 Score = 27.5 bits (58), Expect = 9.7 Identities = 28/86 (32%), Positives = 34/86 (39%), Gaps = 8/86 (9%) Frame = -2 Query: 450 RQRYVPRRLQFQMSQDVLRQNEVLSQISAIFYLTYVAHRHQ---SAPRTQVRKIVSLM-- 286 R+ R ++Q Q LRQ + Q Y V HRH+ PR K S + Sbjct: 62 REHIKAREEEWQRRQQHLRQEKEDRQRELSQYRHQVLHRHEHMGMEPRRPASKSPSTVEH 121 Query: 285 HMT-GLLRSETRTPV--PPIASPRGD 217 H LLR P PPI P GD Sbjct: 122 HPNHSLLRHPYHLPFHPPPIRQPFGD 147 >SB_55804| Best HMM Match : Acyl_transf_1 (HMM E-Value=1.2e-07) Length = 1306 Score = 27.5 bits (58), Expect = 9.7 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 3/52 (5%) Frame = +3 Query: 333 VDVQHRSGKKSRIFVTIPRFDEGRPVTFGTV---DDEGRIVAYPDYSWHENQ 479 V QH++ K+ + F G PV F V + R + P Y+WHE + Sbjct: 221 VSSQHKAFLKNTV---CSLFVSGYPVLFSRVFPRSAQPRFIRLPSYTWHEKE 269 >SB_42738| Best HMM Match : 7tm_1 (HMM E-Value=0.89) Length = 1354 Score = 27.5 bits (58), Expect = 9.7 Identities = 27/109 (24%), Positives = 40/109 (36%) Frame = -2 Query: 603 TLRPEVDNIVYLQSCRRPLSRDDCIHQSQL*TQKLVLRSFAPGFRAKNNPDRQRYVPRRL 424 +L P+ N YL +C R RD C+ T+ L P ++ R L Sbjct: 1170 SLTPDATNAHYL-TCPR---RDHCVLPHIPQTRPLHFTPLTPDANTAHHLTYPRRDHCVL 1225 Query: 423 QFQMSQDVLRQNEVLSQISAIFYLTYVAHRHQSAPRTQVRKIVSLMHMT 277 LR + S + FYLTY H PR +++ +T Sbjct: 1226 PHLPQTGPLRTTPLTSDATTAFYLTYPRRDHCVLPRLPQTRLLRTTSLT 1274 >SB_22845| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1422 Score = 27.5 bits (58), Expect = 9.7 Identities = 28/86 (32%), Positives = 34/86 (39%), Gaps = 8/86 (9%) Frame = -2 Query: 450 RQRYVPRRLQFQMSQDVLRQNEVLSQISAIFYLTYVAHRHQ---SAPRTQVRKIVSLM-- 286 R+ R ++Q Q LRQ + Q Y V HRH+ PR K S + Sbjct: 1147 REHIKAREEEWQRRQQHLRQEKEDRQRELSQYRHQVLHRHEHMGMEPRRPASKSPSTVEH 1206 Query: 285 HMT-GLLRSETRTPV--PPIASPRGD 217 H LLR P PPI P GD Sbjct: 1207 HPNHSLLRHPYHLPFHPPPIRQPFGD 1232 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,308,421 Number of Sequences: 59808 Number of extensions: 473656 Number of successful extensions: 1362 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1220 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1359 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1596754500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -