BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0509 (694 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_07_0248 + 42261373-42261609,42261733-42261905,42261986-422620... 29 4.6 >01_07_0248 + 42261373-42261609,42261733-42261905,42261986-42262058, 42262148-42262282,42262352-42262562,42262886-42263034, 42263169-42263267,42263821-42263989,42264176-42264308, 42264600-42264694,42264774-42264882,42265136-42265295, 42265433-42265594,42265814-42265985,42266254-42266402, 42266914-42266951,42267779-42267839,42267913-42268155, 42268233-42268315,42269521-42269609,42270449-42270495, 42270576-42270656,42270737-42270899,42271077-42271267, 42271691-42271762 Length = 1097 Score = 28.7 bits (61), Expect = 4.6 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = -3 Query: 428 LLENFIYHLAKYKKLL*NSNADXXXXXXXXXXXFISYIHNTFRMKCKGA 282 ++EN Y++ KK L NSN D + +I+ TF + GA Sbjct: 161 MVENLFYNMVARKKTLQNSNDDYPKIVDFISRFAVHHINVTFSCRKHGA 209 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,068,402 Number of Sequences: 37544 Number of extensions: 284084 Number of successful extensions: 484 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 481 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 484 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1768474200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -