BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0509 (694 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcript... 24 5.2 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 23 9.1 DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doub... 23 9.1 >AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 23.8 bits (49), Expect = 5.2 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = -2 Query: 174 MKPSVVLHDLMLYQRNRRNNCESTQQLT 91 + P +L ++ Q+N N CE+ +Q+T Sbjct: 991 VNPDTLLTHMLQSQQNWSNVCEAAKQIT 1018 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.0 bits (47), Expect = 9.1 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -2 Query: 153 HDLMLYQRNRRNNC 112 H+LML +R +R NC Sbjct: 1857 HELMLEERFKRKNC 1870 >DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doublesex protein protein. Length = 622 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/32 (28%), Positives = 18/32 (56%) Frame = -1 Query: 352 SPRKNSANLFHTFIILFE*NVKGPNFEPISRR 257 S +A +FHT + ++ ++ P+ EP R+ Sbjct: 535 SSESTTAPIFHTHFLGYQPQMQLPHVEPFYRK 566 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 663,283 Number of Sequences: 2352 Number of extensions: 13425 Number of successful extensions: 12 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70250040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -