BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0508 (616 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578796-1|AAT07301.1| 437|Anopheles gambiae Gbb-60A protein. 25 1.5 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 25 1.9 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 25 2.6 AY705395-1|AAU12504.1| 569|Anopheles gambiae nicotinic acetylch... 24 4.5 DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor... 23 5.9 AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylch... 23 5.9 AY578795-1|AAT07300.1| 441|Anopheles gambiae Gbb-60A2 protein. 23 5.9 AY705403-1|AAU12512.1| 520|Anopheles gambiae nicotinic acetylch... 23 7.8 AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylch... 23 7.8 AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ chann... 23 7.8 AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium ch... 23 7.8 AJ304411-1|CAC39104.1| 187|Anopheles gambiae LDL receptor protein. 23 7.8 >AY578796-1|AAT07301.1| 437|Anopheles gambiae Gbb-60A protein. Length = 437 Score = 25.4 bits (53), Expect = 1.5 Identities = 15/58 (25%), Positives = 27/58 (46%) Frame = -1 Query: 418 YCNSSLTFQLH*VHNSTNIVFTFNLVHLVYSSSIEQNTFSECCLSRVYVS*YTNISNI 245 YC+ F L+ N+TN LVHL + + + + + L + V + + SN+ Sbjct: 364 YCSGECNFPLNAHMNATNHAIVQTLVHLNHPTKVPKPCCAPTKLIPISVLYHIDESNV 421 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 25.0 bits (52), Expect = 1.9 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +1 Query: 553 CRWCSEPNF 579 CRWC+ PNF Sbjct: 51 CRWCTMPNF 59 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 24.6 bits (51), Expect = 2.6 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 2/49 (4%) Frame = -1 Query: 538 YRPI*NS*-CSFYFYC-EIYMSWSINNVNVMFLPNSVCCSRLYCNSSLT 398 + PI N+ C+F C EI+ SW N + + C S C S +T Sbjct: 780 FAPINNTGDCTFLQDCIEIFCSWCKRNGLTICIEKCYCVSFSRCRSPVT 828 >AY705395-1|AAU12504.1| 569|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 2 protein. Length = 569 Score = 23.8 bits (49), Expect = 4.5 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 Query: 290 TTLTERILFYTGRI 331 TTLT+ IL YTG++ Sbjct: 135 TTLTKAILHYTGKV 148 >DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor 22 protein. Length = 467 Score = 23.4 bits (48), Expect = 5.9 Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Frame = +3 Query: 162 IQKNRVYFKLS-YRNIHHMSNMQNTNHWKIFEILVYQLT*TLERQHSLNVFCSIL 323 I KN L Y NI+ N + + +++ Q TL RQ + N F S L Sbjct: 396 IDKNPPTMNLDGYANINRGLITSNISFMATYLVVLMQFKLTLLRQSAKNAFISAL 450 >AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 23.4 bits (48), Expect = 5.9 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -3 Query: 287 FQSLCELIYQYFEYFPMVCVL 225 ++S CE+ +YF + CVL Sbjct: 148 YKSSCEIDVEYFPFDEQTCVL 168 >AY578795-1|AAT07300.1| 441|Anopheles gambiae Gbb-60A2 protein. Length = 441 Score = 23.4 bits (48), Expect = 5.9 Identities = 14/58 (24%), Positives = 28/58 (48%) Frame = -1 Query: 418 YCNSSLTFQLH*VHNSTNIVFTFNLVHLVYSSSIEQNTFSECCLSRVYVS*YTNISNI 245 +C F L+ N+TN LVHL++ + + + + L+ + V + + +NI Sbjct: 368 FCFGECNFPLNTHMNATNHALIQTLVHLMHPTRVPKPCCAPTKLNPISVLYHIDDANI 425 >AY705403-1|AAU12512.1| 520|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 8 protein. Length = 520 Score = 23.0 bits (47), Expect = 7.8 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -3 Query: 287 FQSLCELIYQYFEYFPMVCVL 225 ++S CE+ +YF Y C++ Sbjct: 150 YKSSCEMNVEYFPYDEQTCLM 170 >AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 23.0 bits (47), Expect = 7.8 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = -3 Query: 287 FQSLCELIYQYFEYFPMVCVLHI 219 ++S C + +YF Y CVL + Sbjct: 148 YKSSCSIDVEYFPYDVQTCVLKL 170 >AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ channel protein. Length = 574 Score = 23.0 bits (47), Expect = 7.8 Identities = 7/24 (29%), Positives = 12/24 (50%) Frame = -1 Query: 514 CSFYFYCEIYMSWSINNVNVMFLP 443 CS YF +Y+ W + + + P Sbjct: 74 CSIYFISNVYIKWQSSPIIIGLNP 97 >AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium channel protein. Length = 572 Score = 23.0 bits (47), Expect = 7.8 Identities = 7/24 (29%), Positives = 12/24 (50%) Frame = -1 Query: 514 CSFYFYCEIYMSWSINNVNVMFLP 443 CS YF +Y+ W + + + P Sbjct: 74 CSIYFISNVYIKWQSSPIIIGLNP 97 >AJ304411-1|CAC39104.1| 187|Anopheles gambiae LDL receptor protein. Length = 187 Score = 23.0 bits (47), Expect = 7.8 Identities = 12/50 (24%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = +2 Query: 305 RILFYTGRIDQMHEVKG-KDNVGAVMDSMELERQRGITIQSAATYTIWKE 451 R L++T ++ EV ++ + + + +LE+ RGI + + Y W + Sbjct: 132 RKLYWTDAGRKVLEVSDLEEGIRSALVWKDLEQPRGIALDYESGYLFWSD 181 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 664,665 Number of Sequences: 2352 Number of extensions: 13369 Number of successful extensions: 27 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 60132501 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -