BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0505 (637 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC20G8.09c |||N-acetyltransferase Nat10 |Schizosaccharomyces p... 29 0.43 SPBC2A9.07c |||zf-PARP-type zinc finger protein|Schizosaccharomy... 28 0.98 SPAP8A3.12c |||tripeptidylpeptidase |Schizosaccharomyces pombe|c... 28 0.98 SPCC10H11.01 |prp11||ATP-dependent RNA helicase Prp11|Schizosacc... 28 1.3 SPBC3B8.04c |||membrane transporter|Schizosaccharomyces pombe|ch... 27 2.3 SPAC3H5.06c |pol1|swi7, polA|DNA polymerase alpha catalytic subu... 27 2.3 SPBC354.05c |sre2||membrane-tethered transcription factor |Schiz... 27 2.3 SPAC3G6.04 |rnp24||RNA-binding protein Rnp24|Schizosaccharomyces... 27 3.0 SPBC1198.11c |reb1|SPBC660.01c|RNA polymerase I transcription te... 27 3.0 SPBC4F6.13c |||WD repeat/BOP1NT protein|Schizosaccharomyces pomb... 26 4.0 SPAC3C7.12 |tip1|noc1|CLIP170 family protein Tip1|Schizosaccharo... 26 4.0 SPAC630.05 |gyp7||GTPase activating protein Gyp7 |Schizosaccharo... 25 6.9 SPCC162.08c |nup211||nuclear pore complex associated protein|Sch... 25 6.9 SPBC31E1.06 |bms1|SPBC800.01|GTP binding protein Bms1|Schizosacc... 25 9.1 SPAC22E12.18 |||conserved fungal protein|Schizosaccharomyces pom... 25 9.1 >SPAC20G8.09c |||N-acetyltransferase Nat10 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1033 Score = 29.5 bits (63), Expect = 0.43 Identities = 20/66 (30%), Positives = 30/66 (45%) Frame = +3 Query: 330 IKTLPSPWTVVTAITKRKTMMNGTTNQGRSNKRTIVIPPMNQSRKLRGGVNQKESRKSHL 509 ++ L P+ V A T +NG GRS ++ QSR G N K +SH+ Sbjct: 396 VRKLIGPYLVFMAST-----INGYEGTGRSLSLKLLQQLREQSRIYSGSGNNKSDSQSHI 450 Query: 510 TRRNLR 527 + R L+ Sbjct: 451 SGRTLK 456 >SPBC2A9.07c |||zf-PARP-type zinc finger protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 274 Score = 28.3 bits (60), Expect = 0.98 Identities = 20/77 (25%), Positives = 33/77 (42%) Frame = +2 Query: 221 NIRDVHRRLWKKRLSDPNRSSKPYKYESQMAFMKAFYKDVAIPLDSGDCDYEEKDYDEWD 400 ++R H+R ++ S PN+ K + S ++ D I + D D EEK W Sbjct: 154 DLRKSHKRKSVEKSSVPNKKHKAERKRSPSPKIEILEDDEEIEDVASDKDEEEK---PWS 210 Query: 401 NESGQEQQENNSDSSDE 451 + + + DS DE Sbjct: 211 GDEEDDDELVVKDSEDE 227 >SPAP8A3.12c |||tripeptidylpeptidase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1274 Score = 28.3 bits (60), Expect = 0.98 Identities = 21/89 (23%), Positives = 39/89 (43%), Gaps = 5/89 (5%) Frame = +2 Query: 131 YMDFNAREVTWQKIGDELKRPA----VDCKIRWINI-RDVHRRLWKKRLSDPNRSSKPYK 295 Y+ R K+ E K P+ V CK+ + +D+ +RL K D N+S++ Sbjct: 147 YLTITGRSGRTLKLSKEWKNPSKKWKVGCKLAYEFFPKDLRKRLQKLETEDMNKSNRKLL 206 Query: 296 YESQMAFMKAFYKDVAIPLDSGDCDYEEK 382 ++ + K K PLD + +++ Sbjct: 207 QDATDEYAKFKDKFPEAPLDKDNLQTQKE 235 >SPCC10H11.01 |prp11||ATP-dependent RNA helicase Prp11|Schizosaccharomyces pombe|chr 3|||Manual Length = 1014 Score = 27.9 bits (59), Expect = 1.3 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 Query: 542 DTGATPELDPADPVDAFLISIASTLKTFSP 631 + A+ E D DP+DA++ S+ T T P Sbjct: 292 EQAASMEEDEVDPLDAYMASLVGTTDTIRP 321 >SPBC3B8.04c |||membrane transporter|Schizosaccharomyces pombe|chr 2|||Manual Length = 867 Score = 27.1 bits (57), Expect = 2.3 Identities = 12/56 (21%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = +2 Query: 281 SKPYKYE-SQMAFMKAFYKDVAIPLDSGDCDYEEKDYDEWDNESGQEQQENNSDSS 445 S+P+ + S+ K + + + D + EE+D D+ D + +++ E+N++++ Sbjct: 172 SEPHDVDTSKNGLSKKQHSEAQPEVQGNDDEVEEEDDDDDDEDEDEDEDEDNNNNN 227 >SPAC3H5.06c |pol1|swi7, polA|DNA polymerase alpha catalytic subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 1405 Score = 27.1 bits (57), Expect = 2.3 Identities = 9/32 (28%), Positives = 14/32 (43%) Frame = +2 Query: 350 LDSGDCDYEEKDYDEWDNESGQEQQENNSDSS 445 +D Y + YDEWD ++ + N S Sbjct: 63 VDDNGAGYVDNGYDEWDQSHYSDEDDENEKGS 94 >SPBC354.05c |sre2||membrane-tethered transcription factor |Schizosaccharomyces pombe|chr 2|||Manual Length = 793 Score = 27.1 bits (57), Expect = 2.3 Identities = 9/32 (28%), Positives = 19/32 (59%) Frame = +2 Query: 203 CKIRWINIRDVHRRLWKKRLSDPNRSSKPYKY 298 C + +++D+HR+L +S+P ++ P Y Sbjct: 2 CPSQHSSLKDIHRQLENTAISNPTENADPSSY 33 >SPAC3G6.04 |rnp24||RNA-binding protein Rnp24|Schizosaccharomyces pombe|chr 1|||Manual Length = 369 Score = 26.6 bits (56), Expect = 3.0 Identities = 22/72 (30%), Positives = 35/72 (48%) Frame = +2 Query: 176 DELKRPAVDCKIRWINIRDVHRRLWKKRLSDPNRSSKPYKYESQMAFMKAFYKDVAIPLD 355 D LK A+ C + +N R++ L K R SKP S+ A +++ K+ + L Sbjct: 176 DALKL-ALQCSEKALNGRNI---LIKSNTDFSGRPSKPANTLSKTASIQSSKKEPSSILF 231 Query: 356 SGDCDYEEKDYD 391 G+ D+E D D Sbjct: 232 VGNLDFETTDAD 243 >SPBC1198.11c |reb1|SPBC660.01c|RNA polymerase I transcription termination factor Reb1|Schizosaccharomyces pombe|chr 2|||Manual Length = 504 Score = 26.6 bits (56), Expect = 3.0 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +2 Query: 161 WQKIGDELKRPAVDCKIRWINIRDVHR 241 W KIG ++ R DC+ RW RDV R Sbjct: 335 WTKIGRKMARMPNDCRDRW---RDVVR 358 >SPBC4F6.13c |||WD repeat/BOP1NT protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 736 Score = 26.2 bits (55), Expect = 4.0 Identities = 16/68 (23%), Positives = 35/68 (51%), Gaps = 1/68 (1%) Frame = +2 Query: 251 KKRLSDPNRSSKPYKYESQMAFMK-AFYKDVAIPLDSGDCDYEEKDYDEWDNESGQEQQE 427 K++ S+ P + E++ + + +F KDV + S + E++ E+ +ESG+ E Sbjct: 21 KEKEKSKGVSNVPNEVETESSSHEPSFKKDVDEEIPSLTAELSEEEEGEYSSESGRSTPE 80 Query: 428 NNSDSSDE 451 + D ++ Sbjct: 81 LSPDDFED 88 >SPAC3C7.12 |tip1|noc1|CLIP170 family protein Tip1|Schizosaccharomyces pombe|chr 1|||Manual Length = 461 Score = 26.2 bits (55), Expect = 4.0 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +2 Query: 368 DYEEKDYDEWDNESGQEQQENNSDSSDE 451 D E E++ E+ QE +EN+SDS D+ Sbjct: 406 DNERMSPAEFELETTQEVEENDSDSHDD 433 >SPAC630.05 |gyp7||GTPase activating protein Gyp7 |Schizosaccharomyces pombe|chr 1|||Manual Length = 743 Score = 25.4 bits (53), Expect = 6.9 Identities = 21/60 (35%), Positives = 30/60 (50%) Frame = -2 Query: 219 IHLILQSTAGLFSSSPIFCHVTSRALKSMYLGLL*SYKTGFCFTKLINVTSVLSRNILLA 40 IH+ A LFS S +F H TS+ +K G L K +K + +SV +ILL+ Sbjct: 22 IHIDNSKVALLFSKSKVFVHPTSK-MKDNISGYLSLSK-----SKALGNSSVAGSDILLS 75 >SPCC162.08c |nup211||nuclear pore complex associated protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 1837 Score = 25.4 bits (53), Expect = 6.9 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = +2 Query: 329 YKDVAIPLDSGDCDYEEKDYDEWDNESGQEQQENNSD 439 + + IPL S DYE D E EQQ NS+ Sbjct: 34 FTSILIPLISKSKDYESIKNDRIVTEVNYEQQLRNSE 70 >SPBC31E1.06 |bms1|SPBC800.01|GTP binding protein Bms1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1121 Score = 25.0 bits (52), Expect = 9.1 Identities = 18/63 (28%), Positives = 33/63 (52%) Frame = +2 Query: 263 SDPNRSSKPYKYESQMAFMKAFYKDVAIPLDSGDCDYEEKDYDEWDNESGQEQQENNSDS 442 S+ +R SK ++ +A +K+ + ++ LDS + E DE + E +EN+SD+ Sbjct: 573 SESDRLSKKWENPQLLAQLKSRFITGSL-LDSIEGQEEVSQDDEEGDFEDLEDEENSSDN 631 Query: 443 SDE 451 E Sbjct: 632 EME 634 >SPAC22E12.18 |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 336 Score = 25.0 bits (52), Expect = 9.1 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = +2 Query: 368 DYEEKDYDEWDNESGQEQQENNSDSSDEPI 457 DY+E D WD + G E ++++ ++ E + Sbjct: 195 DYKEGDDSNWD-DFGSESEDDSKEAHSEEV 223 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,253,402 Number of Sequences: 5004 Number of extensions: 42218 Number of successful extensions: 160 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 154 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 160 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 283719918 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -